KEGG   Homo sapiens (human): 7067Help
Entry
7067              CDS       T01001                                 

Gene name
THRA, AR7, CHNG6, EAR7, ERB-T-1, ERBA, ERBA1, NR1A1, THRA1, THRA2, c-ERBA-1
Definition
(RefSeq) thyroid hormone receptor alpha
  KO
K05547  thyroid hormone receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04919  Thyroid hormone signaling pathway
Disease
H00250  Congenital nongoitrous hypothyroidism (CHNG)
Drug target
Dextrothyroxine: D03750
Levothyroxine (DG00510): D08125
Levothyroxine sodium: D01010
Liothyronine (DG01372): D08128 D08129
Liothyronine sodium: D01011
Thyroid (DG01993): D01012 D06482
Tiratricol: D07214
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    7067 (THRA)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    7067 (THRA)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    7067 (THRA)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1A. Thyroid hormone receptor (THR)
   7067 (THRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep
Motif
Other DBs
NCBI-GeneID: 7067
NCBI-ProteinID: NP_001177848
OMIM: 190120
HGNC: 11796
Ensembl: ENSG00000126351
Vega: OTTHUMG00000133332
Pharos: P10827(Tclin)
UniProt: P10827
Structure
PDB: 

Position
17q21.1
AA seq 490 aa AA seqDB search
MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCSLKTSMSGYIPSYLDKDEQCVVCGDKA
TGYHYRCITCEGCKGFFRRTIQKNLHPTYSCKYDSCCVIDKITRNQCQLCRFKKCIAVGM
AMDLVLDDSKRVAKRKLIEQNRERRRKEEMIRSLQQRPEPTPEEWDLIHIATEAHRSTNA
QGSHWKQRRKFLPDDIGQSPIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFS
ELPCEDQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMAVKREQLKNGGLGVVSDAIF
ELGKSLSAFNLDDTEVALLQAVLLMSTDRSGLLCVDKIEKSQEAYLLAFEHYVNHRKHNI
PHFWPKLLMKEREVQSSILYKGAAAEGRPGGSLGVHPEGQQLLGMHVVQGPQVRQLEQQL
GEAGSLQGPVLQHQSPKSPQQRLLELLHRSGILHARAVCGEDDSSEADSPSSSEEEPEVC
EDLAGNAASP
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggaacagaagccaagcaaggtggagtgtgggtcagacccagaggagaacagtgccagg
tcaccagatggaaagcgaaaaagaaagaacggccaatgttccctgaaaaccagcatgtca
gggtatatccctagttacctggacaaagacgagcagtgtgtcgtgtgtggggacaaggca
actggttatcactaccgctgtatcacttgtgagggctgcaagggcttctttcgccgcaca
atccagaagaacctccatcccacctattcctgcaaatatgacagctgctgtgtcattgac
aagatcacccgcaatcagtgccagctgtgccgcttcaagaagtgcatcgccgtgggcatg
gccatggacttggttctagatgactcgaagcgggtggccaagcgtaagctgattgagcag
aaccgggagcggcggcggaaggaggagatgatccgatcactgcagcagcgaccagagccc
actcctgaagagtgggatctgatccacattgccacagaggcccatcgcagcaccaatgcc
cagggcagccattggaaacagaggcggaaattcctgcccgatgacattggccagtcaccc
attgtctccatgccggacggagacaaggtggacctggaagccttcagcgagtttaccaag
atcatcaccccggccatcacccgtgtggtggactttgccaaaaaactgcccatgttctcc
gagctgccttgcgaagaccagatcatcctcctgaaggggtgctgcatggagatcatgtcc
ctgcgggcggctgtccgctacgaccctgagagcgacaccctgacgctgagtggggagatg
gctgtcaagcgggagcagctcaagaatggcggcctgggcgtagtctccgacgccatcttt
gaactgggcaagtcactctctgcctttaacctggatgacacggaagtggctctgctgcag
gctgtgctgctaatgtcaacagaccgctcgggcctgctgtgtgtggacaagatcgagaag
agtcaggaggcgtacctgctggcgttcgagcactacgtcaaccaccgcaaacacaacatt
ccgcacttctggcccaagctgctgatgaaggagagagaagtgcagagttcgattctgtac
aagggggcagcggcagaaggccggccgggcgggtcactgggcgtccacccggaaggacag
cagcttctcggaatgcatgttgttcagggtccgcaggtccggcagcttgagcagcagctt
ggtgaagcgggaagtctccaagggccggttcttcagcaccagagcccgaagagcccgcag
cagcgtctcctggagctgctccaccgaagcggaattctccatgcccgagcggtctgtggg
gaagacgacagcagtgaggcggactccccgagctcctctgaggaggaaccggaggtctgc
gaggacctggcaggcaatgcagcctctccctga

DBGET integrated database retrieval system