KEGG   Homo sapiens (human): 7068Help
Entry
7068              CDS       T01001                                 

Gene name
THRB, C-ERBA-2, C-ERBA-BETA, ERBA2, GRTH, NR1A2, PRTH, THR1, THRB1, THRB2
Definition
(RefSeq) thyroid hormone receptor beta
  KO
K08362  thyroid hormone receptor beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04919  Thyroid hormone signaling pathway
Disease
H00249  Thyroid hormone resistance syndrome
Drug target
Dextrothyroxine: D03750
Levothyroxine (DG00510): D08125
Levothyroxine sodium: D01010
Liothyronine (DG01372): D08128 D08129
Liothyronine sodium: D01011
Sobetirome: D09381
Thyroid (DG01993): D01012 D06482
Tiratricol: D07214
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    7068 (THRB)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    7068 (THRB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7068 (THRB)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    7068 (THRB)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    7068 (THRB)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1A. Thyroid hormone receptor (THR)
   7068 (THRB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep
Motif
Other DBs
NCBI-GeneID: 7068
NCBI-ProteinID: NP_000452
OMIM: 190160
HGNC: 11799
Ensembl: ENSG00000151090
Vega: OTTHUMG00000130478
Pharos: P10828(Tclin)
UniProt: P10828 F1D8N7
Structure
PDB: 

Position
3p24.2
AA seq 461 aa AA seqDB search
MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLKNEQSSPHLIQ
TTWTSSIFHLDHDDVNDQSVSSAQTFQTEEKKCKGYIPSYLDKDELCVVCGDKATGYHYR
CITCEGCKGFFRRTIQKNLHPSYSCKYEGKCVIDKVTRNQCQECRFKKCIYVGMATDLVL
DDSKRLAKRKLIEENREKRRREELQKSIGHKPEPTDEEWELIKTVTEAHVATNAQGSHWK
QKRKFLPEDIGQAPIVNAPEGGKVDLEAFSHFTKIITPAITRVVDFAKKLPMFCELPCED
QIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGGLGVVSDAIFDLGMSL
SSFNLDDTEVALLQAVLLMSSDRPGLACVERIEKYQDSFLLAFEHYINYRKHHVTHFWPK
LLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgactcccaacagtatgacagaaaatggccttacagcctgggacaaaccgaagcactgt
ccagaccgagaacacgactggaagctagtaggaatgtctgaagcctgcctacataggaag
agccattcagagaggcgcagcacgttgaaaaatgaacagtcgtcgccacatctcatccag
accacttggactagctcaatattccatctggaccatgatgatgtgaacgaccagagtgtc
tcaagtgcccagaccttccaaacggaggagaagaaatgtaaagggtacatccccagttac
ttagacaaggacgagctctgtgtagtgtgtggtgacaaagccaccgggtatcactaccgc
tgtatcacgtgtgaaggctgcaagggtttctttagaagaaccattcagaaaaatctccat
ccatcctattcctgtaaatatgaaggaaaatgtgtcatagacaaagtcacgcgaaatcag
tgccaggaatgtcgctttaagaaatgcatctatgttggcatggcaacagatttggtgctg
gatgacagcaagaggctggccaagaggaagctgatagaggagaaccgggagaaaagacgg
cgggaagagctgcagaagtccatcgggcacaagccagagcccacagacgaggaatgggag
ctcatcaaaactgtcaccgaagcccatgtggcgaccaacgcccaaggcagccactggaag
caaaaacggaaattcctgccagaagacattggacaagcaccaatagtcaatgccccagaa
ggtggaaaggttgacttggaagccttcagccattttacaaaaatcatcacaccagcaatt
accagagtggtggattttgccaaaaagttgcctatgttttgtgagctgccatgtgaagac
cagatcatcctcctcaaaggctgctgcatggagatcatgtcccttcgcgctgctgtgcgc
tatgacccagaaagtgagactttaaccttgaatggggaaatggcagtgacacggggccag
ctgaaaaatgggggtcttggggtggtgtcagacgccatctttgacctgggcatgtctctg
tcttctttcaacctggatgacactgaagtagccctccttcaggccgtcctgctgatgtct
tcagatcgcccggggcttgcctgtgttgagagaatagaaaagtaccaagatagtttcctg
ctggcctttgaacactatatcaattaccgaaaacaccacgtgacacacttttggccaaaa
ctcctgatgaaggtgacagatctgcggatgataggagcctgccatgccagccgcttcctg
cacatgaaggtggaatgccccacagaactcttcccccctttgttcttggaagtgttcgag
gattag

DBGET integrated database retrieval system