KEGG   Homo sapiens (human): 7073
Entry
7073              CDS       T01001                                 
Symbol
TIAL1, TCBP, TIAR
Name
(RefSeq) TIA1 cytotoxic granule associated RNA binding protein like 1
  KO
K13201  nucleolysin TIA-1/TIAR
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    7073 (TIAL1)
   03041 Spliceosome [BR:hsa03041]
    7073 (TIAL1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     7073 (TIAL1)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    7073 (TIAL1)
SSDB
Motif
Pfam: RRM_1 RRM_occluded RRM_7 Nup35_RRM Nup35_RRM_2 Calcipressin XOO_2897-deam
Other DBs
NCBI-GeneID: 7073
NCBI-ProteinID: NP_003243
OMIM: 603413
HGNC: 11804
Ensembl: ENSG00000151923
UniProt: Q01085 Q49AS9
Position
10:complement(119573465..119596964)
AA seq 375 aa
MMEDDGQPRTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEHTSNDPYCFVEFYEHRD
AAAALAAMNGRKILGKEVKVNWATTPSSQKKDTSNHFHVFVGDLSPEITTEDIKSAFAPF
GKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAP
KSTQENNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRVFPEK
GYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWGKESPDMTKNFQQVDYSQWGQWSQVY
GNPQQYGQYMANGWQVPPYGVYGQPWNQQGFGVDQSPSAAWMGGFGAQPPQGQAPPPVIP
PPNQAGYGMASYQTQ
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgatggaagacgacgggcagccccggactctatacgtaggtaacctttccagagatgtg
acagaagtccttatacttcagttgttcagtcagattggaccctgtaaaagctgtaaaatg
ataacagagcatacaagcaatgacccatattgctttgtggaattttatgaacacagagat
gcagctgctgcattagctgctatgaatgggagaaaaattttgggaaaggaggtcaaagta
aactgggcaaccacaccaagtagccagaaaaaagatacttccaatcacttccatgtgttt
gttggggatttgagtccagaaattacaacagaagatatcaaatcagcatttgcccccttt
ggtaaaatatcggatgcccgggtagttaaagacatggcaactggaaaatccaaaggctat
ggttttgtatctttttataacaaactggatgcagaaaatgcgattgtgcatatgggcggt
cagtggttgggtggtcgtcaaatccgaaccaattgggccactcgtaaaccacctgcacct
aaaagtacacaagaaaacaacactaagcagttgagatttgaagatgtagtaaaccagtca
agtccaaaaaattgtactgtgtactgtggaggaattgcgtctgggttaacagatcagctt
atgagacagacattctcaccatttggacaaattatggaaataagagttttcccagaaaag
ggctattcatttgtcagattttcaacccatgaaagtgcagcccatgccattgtttcggtg
aacggtactacgattgaaggacatgtggttaaatgctattggggtaaagaatctcctgat
atgactaaaaacttccaacaggttgactatagtcaatggggccaatggagccaagtgtat
ggaaacccacaacagtatggacagtatatggcaaatgggtggcaagtaccgccttatgga
gtatacgggcaaccatggaatcaacaaggatttggagtagatcaatcaccttctgctgct
tggatgggtggatttggtgctcagcctccccaaggacaagctcctccccctgtaatacct
cctcctaaccaagccggatatggtatggcaagttaccaaacacagtga

DBGET integrated database retrieval system