KEGG   Homo sapiens (human): 7077Help
Entry
7077              CDS       T01001                                 

Gene name
TIMP2, CSC-21K, DDC8
Definition
(RefSeq) TIMP metallopeptidase inhibitor 2
  KO
K22583  metalloproteinase inhibitor 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    7077 (TIMP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIMP NTR
Motif
Other DBs
NCBI-GeneID: 7077
NCBI-ProteinID: NP_003246
OMIM: 188825
HGNC: 11821
Ensembl: ENSG00000035862
Vega: OTTHUMG00000154517
Pharos: P16035(Tbio)
UniProt: P16035 A0A140VK57
Structure
PDB: 

Position
17q25.3
AA seq 220 aa AA seqDB search
MGAAARTLRLALGLLLLATLLRPADACSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGND
IYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDG
KMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTE
KNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccgcggcccgcaccctgcggctggcgctcggcctcctgctgctggcgacgctg
cttcgcccggccgacgcctgcagctgctccccggtgcacccgcaacaggcgttttgcaat
gcagatgtagtgatcagggccaaagcggtcagtgagaaggaagtggactctggaaacgac
atttatggcaaccctatcaagaggatccagtatgagatcaagcagataaagatgttcaaa
gggcctgagaaggatatagagtttatctacacggccccctcctcggcagtgtgtggggtc
tcgctggacgttggaggaaagaaggaatatctcattgcaggaaaggccgagggggacggc
aagatgcacatcaccctctgtgacttcatcgtgccctgggacaccctgagcaccacccag
aagaagagcctgaaccacaggtaccagatgggctgcgagtgcaagatcacgcgctgcccc
atgatcccgtgctacatctcctccccggacgagtgcctctggatggactgggtcacagag
aagaacatcaacgggcaccaggccaagttcttcgcctgcatcaagagaagtgacggctcc
tgtgcgtggtaccgcggcgcggcgccccccaagcaggagtttctcgacatcgaggaccca
taa

DBGET integrated database retrieval system