KEGG   Homo sapiens (human): 7077
Entry
7077              CDS       T01001                                 
Symbol
TIMP2, CSC-21K, DDC8
Name
(RefSeq) TIMP metallopeptidase inhibitor 2
  KO
K22583  metalloproteinase inhibitor 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    7077 (TIMP2)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I35: timp family
   7077 (TIMP2)
SSDB
Motif
Pfam: TIMP NTR
Other DBs
NCBI-GeneID: 7077
NCBI-ProteinID: NP_003246
OMIM: 188825
HGNC: 11821
Ensembl: ENSG00000035862
Pharos: P16035(Tbio)
UniProt: P16035 A0A140VK57
Structure
Position
17:complement(78852977..78925387)
AA seq 220 aa
MGAAARTLRLALGLLLLATLLRPADACSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGND
IYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDG
KMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTE
KNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP
NT seq 663 nt   +upstreamnt  +downstreamnt
atgggcgccgcggcccgcaccctgcggctggcgctcggcctcctgctgctggcgacgctg
cttcgcccggccgacgcctgcagctgctccccggtgcacccgcaacaggcgttttgcaat
gcagatgtagtgatcagggccaaagcggtcagtgagaaggaagtggactctggaaacgac
atttatggcaaccctatcaagaggatccagtatgagatcaagcagataaagatgttcaaa
gggcctgagaaggatatagagtttatctacacggccccctcctcggcagtgtgtggggtc
tcgctggacgttggaggaaagaaggaatatctcattgcaggaaaggccgagggggacggc
aagatgcacatcaccctctgtgacttcatcgtgccctgggacaccctgagcaccacccag
aagaagagcctgaaccacaggtaccagatgggctgcgagtgcaagatcacgcgctgcccc
atgatcccgtgctacatctcctccccggacgagtgcctctggatggactgggtcacagag
aagaacatcaacgggcaccaggccaagttcttcgcctgcatcaagagaagtgacggctcc
tgtgcgtggtaccgcggcgcggcgccccccaagcaggagtttctcgacatcgaggaccca
taa

DBGET integrated database retrieval system