KEGG   Homo sapiens (human): 7079Help
Entry
7079              CDS       T01001                                 

Gene name
TIMP4, TIMP-4
Definition
(RefSeq) TIMP metallopeptidase inhibitor 4
  KO
K22584  metalloproteinase inhibitor 4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    7079 (TIMP4)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I35: timp family
   7079 (TIMP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIMP NTR
Motif
Other DBs
NCBI-GeneID: 7079
NCBI-ProteinID: NP_003247
OMIM: 601915
HGNC: 11823
Ensembl: ENSG00000157150
Vega: OTTHUMG00000129763
Pharos: Q99727(Tbio)
UniProt: Q99727
Position
3p25.2
AA seq 224 aa AA seqDB search
MPGSPRPAPSWVLLLRLLALLRPPGLGEACSCAPAHPQQHICHSALVIRAKISSEKVVPA
SADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQV
LSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTD
WLLERKLYGYQAQHYVCMKHVDGTCSWYRGHLPLRKEFVDIVQP
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgcctgggagccctcggcccgcgccaagctgggtgctgttgctgcggctgctggcgttg
ctgcggcccccggggctgggtgaggcatgcagctgcgccccggcgcaccctcagcagcac
atctgccactcggcacttgtgattcgggccaaaatctccagtgagaaggtagttccggcc
agtgcagaccctgctgacactgaaaaaatgctccggtatgaaatcaaacagataaagatg
ttcaaagggtttgagaaagtcaaggatgttcagtatatctatacgccttttgactcttcc
ctctgtggtgtgaaactagaagccaacagccagaagcagtatctcttgactggtcaggtc
ctcagtgatggaaaagtcttcatccatctgtgcaactacatcgagccctgggaggacctg
tccttggtgcagagggaaagtctgaatcatcactaccatctgaactgtggctgccaaatc
accacctgctacacagtaccctgtaccatctcggcccctaacgagtgcctctggacagac
tggctgttggaacgaaagctctatggttaccaggctcagcattatgtctgtatgaagcat
gttgacggcacctgcagctggtaccggggccacctgcctctcaggaaggagtttgttgac
atcgttcagccctag

DBGET integrated database retrieval system