KEGG   Homo sapiens (human): 7087
Entry
7087              CDS       T01001                                 

Gene name
ICAM5, TLCN, TLN
Definition
(RefSeq) intercellular adhesion molecule 5
  KO
K06769  intercellular adhesion molecule 5
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    7087 (ICAM5)
SSDB
Motif
Pfam: Ig_2 I-set Ig_3 ig ICAM_N V-set C2-set_2
Other DBs
NCBI-GeneID: 7087
NCBI-ProteinID: NP_003250
OMIM: 601852
HGNC: 5348
Ensembl: ENSG00000105376
Vega: OTTHUMG00000180406
Pharos: Q9UMF0(Tbio)
UniProt: Q9UMF0 Q8N6I2
Structure
PDB: 
3BN3 4OI9 4OIB 4OIA

Position
19p13.2
AA seq 924 aa
MPGPSPGLRRALLGLWAALGLGLFGLSAVSQEPFWADLQPRVAFVERGGSLWLNCSTNCP
RPERGGLETSLRRNGTQRGLRWLARQLVDIREPETQPVCFFRCARRTLQARGLIRTFQRP
DRVELMPLPPWQPVGENFTLSCRVPGAGPRASLTLTLLRGAQELIRRSFAGEPPRARGAV
LTATVLARREDHGANFSCRAELDLRPHGLGLFENSSAPRELRTFSLSPDAPRLAAPRLLE
VGSERPVSCTLDGLFPASEARVYLALGDQNLSPDVTLEGDAFVATATATASAEQEGARQL
VCNVTLGGENRETRENVTIYSFPAPLLTLSEPSVSEGQMVTVTCAAGAQALVTLEGVPAA
VPGQPAQLQLNATENDDRRSFFCDATLDVDGETLIKNRSAELRVLYAPRLDDSDCPRSWT
WPEGPEQTLRCEARGNPEPSVHCARSDGGAVLALGLLGPVTRALSGTYRCKAANDQGEAV
KDVTLTVEYAPALDSVGCPERITWLEGTEASLSCVAHGVPPPDVICVRSGELGAVIEGLL
RVAREHAGTYRCEATNPRGSAAKNVAVTVEYGPRFEEPSCPSNWTWVEGSGRLFSCEVDG
KPQPSVKCVGSGGATEGVLLPLAPPDPSPRAPRIPRVLAPGIYVCNATNRHGSVAKTVVV
SAESPPEMDESTCPSHQTWLEGAEASALACAARGRPSPGVRCSREGIPWPEQQRVSREDA
GTYHCVATNAHGTDSRTVTVGVEYRPVVAELAASPPGGVRPGGNFTLTCRAEAWPPAQIS
WRAPPGALNIGLSSNNSTLSVAGAMGSHGGEYECAATNAHGRHARRITVRVAGPWLWVAV
GGAAGGAALLAAGAGLAFYVQSTACKKGEYNVQEAESSGEAVCLNGAGGGAGGAAGAEGG
PEAAGGAAESPAEGEVFAIQLTSA
NT seq 2775 nt   +upstreamnt  +downstreamnt
atgccagggccttcgccagggctgcgccgggcgctactcggcctctgggctgctctgggc
ctggggctcttcggcctctcagcggtctcgcaggagcccttctgggcggacctgcagcct
cgcgtggcgttcgtggagcgcgggggctcgctgtggctgaattgcagcaccaactgccct
cggccggagcgcggtggcctggagacctcgctgcgccgaaacgggacccagaggggtttg
cgttggttggcgcggcagctggtggacattcgcgagccggagactcagcccgtctgcttc
ttccgctgcgcgcggcgcacactacaggcgcgtgggctcattcgcactttccagcgacca
gatcgcgtagagctgatgccgctgcctccctggcagccggtgggcgagaacttcaccctg
agctgtagggtccccggcgccgggccccgtgcgagcctcacgctgaccctgctgcggggc
gcccaggagctgatccgccgcagcttcgccggtgaaccaccccgagcgcggggcgcggtg
ctcacagccacggtactggctcggagggaggaccatggagccaatttctcgtgtcgcgcc
gagctggacctgcggccgcacggactgggactgtttgaaaacagctcggcccccagagag
ctccgaaccttctccctgtctccggatgccccgcgcctcgctgctccccggctcttggaa
gttggctcggaaaggcccgtgagctgcactctggacggactgtttccagcctcagaggcc
agggtctacctcgcactgggggaccagaatctgagtcctgatgtcaccctcgaaggggac
gcattcgtggccactgccacagccacagctagcgcagagcaggagggtgccaggcagctg
gtctgcaacgtcaccctggggggcgaaaaccgggagacccgggagaacgtgaccatctac
agcttcccggcaccactcctgaccctgagcgaacccagcgtctccgaggggcagatggtg
acagtaacctgcgcagctggggcccaagctctggtcacactggagggagttccagccgcg
gtcccggggcagcccgcccagcttcagctaaatgccaccgagaacgacgacagacgcagc
ttcttctgcgacgccaccctcgatgtggacggggagaccctgatcaagaacaggagcgca
gagcttcgtgtcctatacgctccccggctagacgattcggactgccccaggagttggacg
tggcccgagggcccagagcagacgctgcgctgcgaggcccgcgggaacccagaaccctca
gtgcactgtgcgcgctccgacggcggggccgtgctggctctgggcctgctgggtccagtc
actcgggcgctctcaggcacttaccgctgcaaggcggccaatgatcaaggcgaggcggtc
aaggacgtaacgctaacggtggagtacgcaccagcgctggacagcgtgggctgcccagaa
cgcattacttggctggagggaacagaagcctcgctgagctgtgtggcgcacggggtaccg
ccgcctgatgtgatctgcgtgcgctctggagaactcggggccgtcatcgaggggctgttg
cgtgtggcccgggagcatgcgggcacttaccgctgcgaagccaccaaccctcggggctct
gcggccaaaaatgtggccgtcacggtggaatatggccccaggtttgaggagccgagctgc
cccagcaattggacatgggtggaaggatctgggcgcctgttttcctgtgaggtcgatggg
aagccacagccaagcgtgaagtgcgtgggctccgggggcgccactgagggggtgctgctg
ccgctggcacccccagaccctagtcccagagctcccagaatccctagagtcctggcaccc
ggtatctacgtctgcaacgccaccaaccgccacggctccgtggccaaaacagtcgtcgtg
agcgcggagtcgccaccggagatggatgaatctacctgcccaagtcaccagacgtggctg
gaaggggctgaggcttccgcgctggcctgcgccgcccggggtcgcccttccccaggagtg
cgctgctctcgggaaggcatcccatggcctgagcagcagcgcgtgtcccgagaggacgcg
ggcacttaccactgtgtggccaccaatgcgcatggcacggactcccggaccgtcactgtg
ggcgtggaataccggccagtggtggccgaacttgctgcctcgccccctggaggcgtgcgc
ccaggaggaaacttcacgttgacctgccgcgcggaggcctggcctccagcccagatcagc
tggcgcgcgcccccgggggccctcaacatcggcctgtcgagcaacaacagcacactgagc
gtggcaggcgccatgggaagccacggcggcgagtacgagtgcgcagccaccaacgcgcac
gggcgccacgcgcggcgcatcacggtgcgcgtggccggtccgtggctatgggtcgccgtg
ggcggcgcggcggggggcgcggcgctgctggccgcgggggccggcctggccttctacgtg
cagtccaccgcctgcaagaagggcgagtacaacgtgcaggaggccgagagctcaggcgag
gccgtgtgtctgaacggagcgggcggcggcgctggcggggcggcaggcgcggagggcgga
cccgaggcggcggggggcgcggccgagtcgccggcggagggcgaggtcttcgccatacag
ctgacatcggcgtga

DBGET integrated database retrieval system