KEGG   Homo sapiens (human): 7088
Entry
7088              CDS       T01001                                 

Gene name
TLE1, ESG, ESG1, GRG1
Definition
(RefSeq) TLE family member 1, transcriptional corepressor
  KO
K04497  groucho
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
hsa04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    7088 (TLE1)
   04330 Notch signaling pathway
    7088 (TLE1)
SSDB
Motif
Pfam: TLE_N WD40 ANAPC4_WD40 HALZ
Other DBs
NCBI-GeneID: 7088
NCBI-ProteinID: NP_005068
OMIM: 600189
HGNC: 11837
Ensembl: ENSG00000196781
Vega: OTTHUMG00000021008
Pharos: Q04724(Tbio)
UniProt: Q04724 Q59EF7
Structure
PDB: 

Position
9q21.32
AA seq 770 aa
MFPQSRHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRH
YVMYYEMSYGLNIEMHKQTEIAKRLNTICAQVIPFLSQEHQQQVAQAVERAKQVTMAELN
AIIGQQQLQAQHLSHGHGPPVPLTPHPSGLQPPGIPPLGGSAGLLALSSALSGQSHLAIK
DDKKHHDAEHHRDREPGTSNSLLVPDSLRGTDKRRNGPEFSNDIKKRKVDDKDSSHYDSD
GDKSDDNLVVDVSNEDPSSPRASPAHSPRENGIDKNRLLKKDASSSPASTASSASSTSLK
SKEMSLHEKASTPVLKSSTPTPRSDMPTPGTSATPGLRPGLGKPPAIDPLVNQAAAGLRT
PLAVPGPYPAPFGMVPHAGMNGELTSPGAAYASLHNMSPQMSAAAAAAAVVAYGRSPMVG
FDPPPHMRVPTIPPNLAGIPGGKPAYSFHVTADGQMQPVPFPPDALIGPGIPRHARQINT
LNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLP
DGCTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAV
WDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQI
FSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDN
LLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY
NT seq 2313 nt   +upstreamnt  +downstreamnt
atgttcccgcagagccggcacccgacgccgcaccaggctgcaggccagcccttcaagttc
actatcccggagtccctggaccggattaaagaggaattccagttcctgcaggcgcagtat
cacagccttaaattggaatgtgagaaactggcaagtgaaaagacagaaatgcagaggcac
tatgtgatgtattatgaaatgtcatatggattaaacattgaaatgcacaaacagactgaa
atcgccaagagattgaatacgatttgtgcacaagtcatcccatttctgtctcaggaacat
caacaacaggtggcccaggctgttgaacgtgccaaacaggtgaccatggcagaattgaat
gccatcatcgggcagcagcagttgcaagctcagcatctttctcatggccacggaccccca
gttccccttacgcctcacccttcgggacttcagcctcctggaatcccgcccctcgggggc
agtgccggccttcttgcgctgtctagtgctctgagtgggcagtctcacttggcaataaaa
gatgacaagaagcaccacgatgcagagcaccacagagacagagagccgggcacaagtaat
tccctcctggtcccagacagtctaagaggcacagataaacgcagaaatggacctgaattt
tccaatgacatcaagaaaaggaaggtggatgataaggactccagccactatgacagtgat
ggtgacaaaagcgatgacaacttagttgtggatgtgtctaatgaggacccttcttctccg
cgagcaagccctgcccactcgccccgggaaaatggaatcgacaaaaatcgcctgctaaag
aaggatgcttctagcagtccagcttccacggcctcctcggcaagttccacttctttgaaa
tccaaagaaatgagcttgcatgaaaaagccagcacgcctgttctgaaatccagcacacca
acgcctcggagcgacatgccaacgccgggcaccagcgccactccaggcctccgtccaggt
ctcggcaagcctccagccatagaccccctcgttaaccaagcggcagctggcttgaggaca
cccctggcagtgcccggcccatatcctgctccttttgggatggtcccccacgctggcatg
aacggcgagctgaccagcccaggcgctgcctacgccagtttacacaacatgtcgccccag
atgagcgccgcagccgccgcggccgccgtggtggcctacgggcgctcccccatggtgggg
tttgatcctccccctcacatgagagtacctaccattcctccaaacctggcaggaatccct
ggggggaaacctgcatactccttccacgttactgcagacggtcagatgcagcctgtccct
tttccccccgacgccctcatcggacccggaatcccccggcatgctcgccagatcaacacc
ctcaaccacggggaggtggtgtgcgctgtgaccatcagcaaccccacgagacacgtgtac
acaggcgggaagggctgcgtcaaggtctgggacatcagccaccctggcaataagagccct
gtctcccagctcgactgtctgaacagagacaattatatccgttcctgtaaattgctaccc
gatggctgcactctcatagtgggaggggaagccagtactttgtccatttgggacctggcg
gctccaaccccgcgcatcaaggcggagctgacgtcctcggcccccgcctgctacgccctg
gccatcagccccgattccaaggtctgcttctcatgctgcagcgacggcaacatcgctgtg
tgggatctgcacaaccagacactagtgaggcaattccagggccacacagacggagccagc
tgtattgacatttctaatgatggcaccaagctctggacgggtggtttggacaacacagtc
aggtcctgggacctgcgcgaggggcggcagctgcagcagcacgacttcacctcccagatc
ttctccctggggtactgccccaccggggagtggctggcagtgggcatggagagcagcaat
gtggaggtgctgcacgtgaacaagcctgacaagtaccagctgcacctgcatgagagctgc
gtgctgtccctgaaatttgcttactgtggtaaatggtttgtgagtactggaaaagataac
ctcctcaatgcttggcggaccccctatggagccagcatattccagtccaaagagtcctcg
tcagtgcttagctgtgacatctctgtggatgataagtacatagtcactggctcgggggac
aagaaggctacagtctatgaagtcatctactga

DBGET integrated database retrieval system