KEGG   Homo sapiens (human): 7088
Entry
7088              CDS       T01001                                 
Symbol
TLE1, ESG, ESG1, GRG1, TLE-1
Name
(RefSeq) TLE family member 1, transcriptional corepressor
  KO
K04497  groucho
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
hsa04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    7088 (TLE1)
   04330 Notch signaling pathway
    7088 (TLE1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    7088 (TLE1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    ADF / Cofilin
     SCMC complex
      7088 (TLE1)
SSDB
Motif
Pfam: TLE_N WD40 ANAPC4_WD40 NBCH_WD40 HALZ
Other DBs
NCBI-GeneID: 7088
NCBI-ProteinID: NP_005068
OMIM: 600189
HGNC: 11837
Ensembl: ENSG00000196781
UniProt: Q04724 Q59EF7
Position
9:complement(81583683..81689547)
AA seq 770 aa
MFPQSRHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRH
YVMYYEMSYGLNIEMHKQTEIAKRLNTICAQVIPFLSQEHQQQVAQAVERAKQVTMAELN
AIIGQQQLQAQHLSHGHGPPVPLTPHPSGLQPPGIPPLGGSAGLLALSSALSGQSHLAIK
DDKKHHDAEHHRDREPGTSNSLLVPDSLRGTDKRRNGPEFSNDIKKRKVDDKDSSHYDSD
GDKSDDNLVVDVSNEDPSSPRASPAHSPRENGIDKNRLLKKDASSSPASTASSASSTSLK
SKEMSLHEKASTPVLKSSTPTPRSDMPTPGTSATPGLRPGLGKPPAIDPLVNQAAAGLRT
PLAVPGPYPAPFGMVPHAGMNGELTSPGAAYASLHNMSPQMSAAAAAAAVVAYGRSPMVG
FDPPPHMRVPTIPPNLAGIPGGKPAYSFHVTADGQMQPVPFPPDALIGPGIPRHARQINT
LNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLP
DGCTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAV
WDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQI
FSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDN
LLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY
NT seq 2313 nt   +upstreamnt  +downstreamnt
atgttcccgcagagccggcacccgacgccgcaccaggctgcaggccagcccttcaagttc
actatcccggagtccctggaccggattaaagaggaattccagttcctgcaggcgcagtat
cacagccttaaattggaatgtgagaaactggcaagtgaaaagacagaaatgcagaggcac
tatgtgatgtattatgaaatgtcatatggattaaacattgaaatgcacaaacagactgaa
atcgccaagagattgaatacgatttgtgcacaagtcatcccatttctgtctcaggaacat
caacaacaggtggcccaggctgttgaacgtgccaaacaggtgaccatggcagaattgaat
gccatcatcgggcagcagcagttgcaagctcagcatctttctcatggccacggaccccca
gttccccttacgcctcacccttcgggacttcagcctcctggaatcccgcccctcgggggc
agtgccggccttcttgcgctgtctagtgctctgagtgggcagtctcacttggcaataaaa
gatgacaagaagcaccacgatgcagagcaccacagagacagagagccgggcacaagtaat
tccctcctggtcccagacagtctaagaggcacagataaacgcagaaatggacctgaattt
tccaatgacatcaagaaaaggaaggtggatgataaggactccagccactatgacagtgat
ggtgacaaaagcgatgacaacttagttgtggatgtgtctaatgaggacccttcttctccg
cgagcaagccctgcccactcgccccgggaaaatggaatcgacaaaaatcgcctgctaaag
aaggatgcttctagcagtccagcttccacggcctcctcggcaagttccacttctttgaaa
tccaaagaaatgagcttgcatgaaaaagccagcacgcctgttctgaaatccagcacacca
acgcctcggagcgacatgccaacgccgggcaccagcgccactccaggcctccgtccaggt
ctcggcaagcctccagccatagaccccctcgttaaccaagcggcagctggcttgaggaca
cccctggcagtgcccggcccatatcctgctccttttgggatggtcccccacgctggcatg
aacggcgagctgaccagcccaggcgctgcctacgccagtttacacaacatgtcgccccag
atgagcgccgcagccgccgcggccgccgtggtggcctacgggcgctcccccatggtgggg
tttgatcctccccctcacatgagagtacctaccattcctccaaacctggcaggaatccct
ggggggaaacctgcatactccttccacgttactgcagacggtcagatgcagcctgtccct
tttccccccgacgccctcatcggacccggaatcccccggcatgctcgccagatcaacacc
ctcaaccacggggaggtggtgtgcgctgtgaccatcagcaaccccacgagacacgtgtac
acaggcgggaagggctgcgtcaaggtctgggacatcagccaccctggcaataagagccct
gtctcccagctcgactgtctgaacagagacaattatatccgttcctgtaaattgctaccc
gatggctgcactctcatagtgggaggggaagccagtactttgtccatttgggacctggcg
gctccaaccccgcgcatcaaggcggagctgacgtcctcggcccccgcctgctacgccctg
gccatcagccccgattccaaggtctgcttctcatgctgcagcgacggcaacatcgctgtg
tgggatctgcacaaccagacactagtgaggcaattccagggccacacagacggagccagc
tgtattgacatttctaatgatggcaccaagctctggacgggtggtttggacaacacagtc
aggtcctgggacctgcgcgaggggcggcagctgcagcagcacgacttcacctcccagatc
ttctccctggggtactgccccaccggggagtggctggcagtgggcatggagagcagcaat
gtggaggtgctgcacgtgaacaagcctgacaagtaccagctgcacctgcatgagagctgc
gtgctgtccctgaaatttgcttactgtggtaaatggtttgtgagtactggaaaagataac
ctcctcaatgcttggcggaccccctatggagccagcatattccagtccaaagagtcctcg
tcagtgcttagctgtgacatctctgtggatgataagtacatagtcactggctcgggggac
aagaaggctacagtctatgaagtcatctactga

DBGET integrated database retrieval system