KEGG   Homo sapiens (human): 7096Help
Entry
7096              CDS       T01001                                 

Gene name
TLR1, CD281, TIL, TIL._LPRS5, rsc786
Definition
(RefSeq) toll like receptor 1
  KO
K05398  toll-like receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04620  Toll-like receptor signaling pathway
hsa05152  Tuberculosis
Disease
H00344  Leprosy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    7096 (TLR1)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    7096 (TLR1)
Pattern recognition receptors [BR:hsa04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   7096 (TLR1)
CD molecules [BR:hsa04090]
 Proteins
  7096 (TLR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIR LRR_8 LRR_4 TIR_2 LRR_9 LRRCT Tautomerase
Motif
Other DBs
NCBI-GeneID: 7096
NCBI-ProteinID: NP_003254
OMIM: 601194
HGNC: 11847
Ensembl: ENSG00000174125
Vega: OTTHUMG00000160413
Pharos: Q15399(Tbio)
UniProt: Q15399
Structure
PDB: 

Position
4p14
AA seq 786 aa AA seqDB search
MTSIFHFAIIFMLILQIRIQLSEESEFLVDRSKNGLIHVPKDLSQKTTILNISQNYISEL
WTSDILSLSKLRILIISHNRIQYLDISVFKFNQELEYLDLSHNKLVKISCHPTVNLKHLD
LSFNAFDALPICKEFGNMSQLKFLGLSTTHLEKSSVLPIAHLNISKVLLVLGETYGEKED
PEGLQDFNTESLHIVFPTNKEFHFILDVSVKTVANLELSNIKCVLEDNKCSYFLSILAKL
QTNPKLSNLTLNNIETTWNSFIRILQLVWHTTVWYFSISNVKLQGQLDFRDFDYSGTSLK
ALSIHQVVSDVFGFPQSYIYEIFSNMNIKNFTVSGTRMVHMLCPSKISPFLHLDFSNNLL
TDTVFENCGHLTELETLILQMNQLKELSKIAEMTTQMKSLQQLDISQNSVSYDEKKGDCS
WTKSLLSLNMSSNILTDTIFRCLPPRIKVLDLHSNKIKSIPKQVVKLEALQELNVAFNSL
TDLPGCGSFSSLSVLIIDHNSVSHPSADFFQSCQKMRSIKAGDNPFQCTCELGEFVKNID
QVSSEVLEGWPDSYKCDYPESYRGTLLKDFHMSELSCNITLLIVTIVATMLVLAVTVTSL
CSYLDLPWYLRMVCQWTQTRRRARNIPLEELQRNLQFHAFISYSGHDSFWVKNELLPNLE
KEGMQICLHERNFVPGKSIVENIITCIEKSYKSIFVLSPNFVQSEWCHYELYFAHHNLFH
EGSNSLILILLEPIPQYSIPSSYHKLKSLMARRTYLEWPKEKSKRGLFWANLRAAINIKL
TEQAKK
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atgactagcatcttccattttgccattatcttcatgttaatacttcagatcagaatacaa
ttatctgaagaaagtgaatttttagttgataggtcaaaaaacggtctcatccacgttcct
aaagacctatcccagaaaacaacaatcttaaatatatcgcaaaattatatatctgagctt
tggacttctgacatcttatcactgtcaaaactgaggattttgataatttctcataataga
atccagtatcttgatatcagtgttttcaaattcaaccaggaattggaatacttggatttg
tcccacaacaagttggtgaagatttcttgccaccctactgtgaacctcaagcacttggac
ctgtcatttaatgcatttgatgccctgcctatatgcaaagagtttggcaatatgtctcaa
ctaaaatttctggggttgagcaccacacacttagaaaaatctagtgtgctgccaattgct
catttgaatatcagcaaggtcttgctggtcttaggagagacttatggggaaaaagaagac
cctgagggccttcaagactttaacactgagagtctgcacattgtgttccccacaaacaaa
gaattccattttattttggatgtgtcagtcaagactgtagcaaatctggaactatctaat
atcaaatgtgtgctagaagataacaaatgttcttacttcctaagtattctggcgaaactt
caaacaaatccaaagttatcaaatcttaccttaaacaacattgaaacaacttggaattct
ttcattaggatcctccagctggtttggcatacaactgtatggtatttctcaatttcaaac
gtgaagctacagggtcagctggacttcagagattttgattattctggcacttccttgaag
gccttgtctatacaccaagttgtcagcgatgtgttcggttttccgcaaagttatatctat
gaaatcttttcgaatatgaacatcaaaaatttcacagtgtctggtacacgcatggtccac
atgctttgcccatccaaaattagcccgttcctgcatttggatttttccaataatctctta
acagacacggtttttgaaaattgtgggcaccttactgagttggagacacttattttacaa
atgaatcaattaaaagaactttcaaaaatagctgaaatgactacacagatgaagtctctg
caacaattggatattagccagaattctgtaagctatgatgaaaagaaaggagactgttct
tggactaaaagtttattaagtttaaatatgtcttcaaatatacttactgacactattttc
agatgtttacctcccaggatcaaggtacttgatcttcacagcaataaaataaagagcatt
cctaaacaagtcgtaaaactggaagctttgcaagaactcaatgttgctttcaattcttta
actgaccttcctggatgtggcagctttagcagcctttctgtattgatcattgatcacaat
tcagtttcccacccatcggctgatttcttccagagctgccagaagatgaggtcaataaaa
gcaggggacaatccattccaatgtacctgtgagctaggagaatttgtcaaaaatatagac
caagtatcaagtgaagtgttagagggctggcctgattcttataagtgtgactacccggaa
agttatagaggaaccctactaaaggactttcacatgtctgaattatcctgcaacataact
ctgctgatcgtcaccatcgttgccaccatgctggtgttggctgtgactgtgacctccctc
tgcagctacttggatctgccctggtatctcaggatggtgtgccagtggacccagacccgg
cgcagggccaggaacatacccttagaagaactccaaagaaatctccagtttcatgcattt
atttcatatagtgggcacgattctttctgggtgaagaatgaattattgccaaacctagag
aaagaaggtatgcagatttgccttcatgagagaaactttgttcctggcaagagcattgtg
gaaaatatcatcacctgcattgagaagagttacaagtccatctttgttttgtctcccaac
tttgtccagagtgaatggtgccattatgaactctactttgcccatcacaatctctttcat
gaaggatctaatagcttaatcctgatcttgctggaacccattccgcagtactccattcct
agcagttatcacaagctcaaaagtctcatggccaggaggacttatttggaatggcccaag
gaaaagagcaaacgtggccttttttgggctaacttaagggcagccattaatattaagctg
acagagcaagcaaagaaatag

DBGET integrated database retrieval system