KEGG   Homo sapiens (human): 7097Help
Entry
7097              CDS       T01001                                 

Gene name
TLR2, CD282, TIL4
Definition
(RefSeq) toll like receptor 2
  KO
K10159  toll-like receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04151  PI3K-Akt signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa05134  Legionellosis
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05144  Malaria
hsa05145  Toxoplasmosis
hsa05146  Amoebiasis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05162  Measles
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05205  Proteoglycans in cancer
hsa05321  Inflammatory bowel disease (IBD)
hsa05323  Rheumatoid arthritis
Module
hsa_M00686  Toll-like receptor signaling
Network
N00435  TLR2/4-NFKB signaling pathway
N00438  TLR2/4-MAPK signaling pathway
Disease
H00344  Leprosy
H01358  Atopic dermatitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    7097 (TLR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    7097 (TLR2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    7097 (TLR2)
 09160 Human Diseases
  09161 Cancers: Overview
   05205 Proteoglycans in cancer
    7097 (TLR2)
  09163 Immune diseases
   05323 Rheumatoid arthritis
    7097 (TLR2)
   05321 Inflammatory bowel disease (IBD)
    7097 (TLR2)
  09171 Infectious diseases: Bacterial
   05134 Legionellosis
    7097 (TLR2)
   05152 Tuberculosis
    7097 (TLR2)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    7097 (TLR2)
   05162 Measles
    7097 (TLR2)
   05161 Hepatitis B
    7097 (TLR2)
   05168 Herpes simplex infection
    7097 (TLR2)
   05169 Epstein-Barr virus infection
    7097 (TLR2)
  09174 Infectious diseases: Parasitic
   05146 Amoebiasis
    7097 (TLR2)
   05144 Malaria
    7097 (TLR2)
   05145 Toxoplasmosis
    7097 (TLR2)
   05140 Leishmaniasis
    7097 (TLR2)
   05142 Chagas disease (American trypanosomiasis)
    7097 (TLR2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    7097 (TLR2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7097 (TLR2)
   04054 Pattern recognition receptors [BR:hsa04054]
    7097 (TLR2)
   04090 CD molecules [BR:hsa04090]
    7097 (TLR2)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7097 (TLR2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Toll-like receptors
    7097 (TLR2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   7097 (TLR2)
Pattern recognition receptors [BR:hsa04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   7097 (TLR2)
CD molecules [BR:hsa04090]
 Proteins
  7097 (TLR2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Hyaluronan
  Cell surface receptors
   7097 (TLR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 TIR LRR_4 TIR_2 LRR_9 LRR_5 LRR_1 LRRCT DUF1863
Motif
Other DBs
NCBI-GeneID: 7097
NCBI-ProteinID: NP_001305716
OMIM: 603028
HGNC: 11848
Ensembl: ENSG00000137462
Vega: OTTHUMG00000161525
Pharos: O60603(Tchem)
UniProt: O60603 B3KWR9 A0A0S2Z4S4
Structure
PDB: 

Position
4q31.3
AA seq 784 aa AA seqDB search
MPHTLWMVWVLGVIISLSKEESSNQASLSCDRNGICKGSSGSLNSIPSGLTEAVKSLDLS
NNRITYISNSDLQRCVNLQALVLTSNGINTIEEDSFSSLGSLEHLDLSYNYLSNLSSSWF
KPLSSLTFLNLLGNPYKTLGETSLFSHLTKLQILRVGNMDTFTKIQRKDFAGLTFLEELE
IDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFVDVTSSVECLELRDTDLDTFHFS
ELSTGETNSLIKKFTFRNVKITDESLFQVMKLLNQISGLLELEFDDCTLNGVGNFRASDN
DRVIDPGKVETLTIRRLHIPRFYLFYDLSTLYSLTERVKRITVENSKVFLVPCLLSQHLK
SLEYLDLSENLMVEEYLKNSACEDAWPSLQTLILRQNHLASLEKTGETLLTLKNLTNIDI
SKNSFHSMPETCQWPEKMKYLNLSSTRIHSVTGCIPKTLEILDVSNNNLNLFSLNLPQLK
ELYISRNKLMTLPDASLLPMLLVLKISRNAITTFSKEQLDSFHTLKTLEAGGNNFICSCE
FLSFTQEQQALAKVLIDWPANYLCDSPSHVRGQQVQDVRLSVSECHRTALVSGMCCALFL
LILLTGVLCHRFHGLWYMKMMWAWLQAKRKPRKAPSRNICYDAFVSYSERDAYWVENLMV
QELENFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTVFVLSENFVKSEWCKYELDFS
HFRLFDENNDAAILILLEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRA
AIKS
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgccacatactttgtggatggtgtgggtcttgggggtcatcatcagcctctccaaggaa
gaatcctccaatcaggcttctctgtcttgtgaccgcaatggtatctgcaagggcagctca
ggatctttaaactccattccctcagggctcacagaagctgtaaaaagccttgacctgtcc
aacaacaggatcacctacattagcaacagtgacctacagaggtgtgtgaacctccaggct
ctggtgctgacatccaatggaattaacacaatagaggaagattctttttcttccctgggc
agtcttgaacatttagacttatcctataattacttatctaatttatcgtcttcctggttc
aagcccctttcttctttaacattcttaaacttactgggaaatccttacaaaaccctaggg
gaaacatctcttttttctcatctcacaaaattgcaaatcctgagagtgggaaatatggac
accttcactaagattcaaagaaaagattttgctggacttaccttccttgaggaacttgag
attgatgcttcagatctacagagctatgagccaaaaagtttgaagtcaattcagaatgta
agtcatctgatccttcatatgaagcagcatattttactgctggagatttttgtagatgtt
acaagttccgtggaatgtttggaactgcgagatactgatttggacactttccatttttca
gaactatccactggtgaaacaaattcattgattaaaaagtttacatttagaaatgtgaaa
atcaccgatgaaagtttgtttcaggttatgaaacttttgaatcagatttctggattgtta
gaattagagtttgatgactgtacccttaatggagttggtaattttagagcatctgataat
gacagagttatagatccaggtaaagtggaaacgttaacaatccggaggctgcatattcca
aggttttacttattttatgatctgagcactttatattcacttacagaaagagttaaaaga
atcacagtagaaaacagtaaagtttttctggttccttgtttactttcacaacatttaaaa
tcattagaatacttggatctcagtgaaaatttgatggttgaagaatacttgaaaaattca
gcctgtgaggatgcctggccctctctacaaactttaattttaaggcaaaatcatttggca
tcattggaaaaaaccggagagactttgctcactctgaaaaacttgactaacattgatatc
agtaagaatagttttcattctatgcctgaaacttgtcagtggccagaaaagatgaaatat
ttgaacttatccagcacacgaatacacagtgtaacaggctgcattcccaagacactggaa
attttagatgttagcaacaacaatctcaatttattttctttgaatttgccgcaactcaaa
gaactttatatttccagaaataagttgatgactctaccagatgcctccctcttacccatg
ttactagtattgaaaatcagtaggaatgcaataactacgttttctaaggagcaacttgac
tcatttcacacactgaagactttggaagctggtggcaataacttcatttgctcctgtgaa
ttcctctccttcactcaggagcagcaagcactggccaaagtcttgattgattggccagca
aattacctgtgtgactctccatcccatgtgcgtggccagcaggttcaggatgtccgcctc
tcggtgtcggaatgtcacaggacagcactggtgtctggcatgtgctgtgctctgttcctg
ctgatcctgctcacgggggtcctgtgccaccgtttccatggcctgtggtatatgaaaatg
atgtgggcctggctccaggccaaaaggaagcccaggaaagctcccagcaggaacatctgc
tatgatgcatttgtttcttacagtgagcgggatgcctactgggtggagaaccttatggtc
caggagctggagaacttcaatccccccttcaagttgtgtcttcataagcgggacttcatt
cctggcaagtggatcattgacaatatcattgactccattgaaaagagccacaaaactgtc
tttgtgctttctgaaaactttgtgaagagtgagtggtgcaagtatgaactggacttctcc
catttccgtctttttgatgagaacaatgatgctgccattctcattcttctggagcccatt
gagaaaaaagccattccccagcgcttctgcaagctgcggaagataatgaacaccaagacc
tacctggagtggcccatggacgaggctcagcgggaaggattttgggtaaatctgagagct
gcgataaagtcctag

DBGET integrated database retrieval system