KEGG   Homo sapiens (human): 7098Help
Entry
7098              CDS       T01001                                 

Gene name
TLR3, CD283, IIAE2
Definition
(RefSeq) toll like receptor 3
  KO
K05401  toll-like receptor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
Network
nt06121  TLR signaling (viruses and bacteria)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06166  Human papillomavirus (HPV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06221  TLR signaling
nt06263  Hepatocellular carcinoma
  Element
N00148  TLR3-IRF7 signaling pathway
N00149  TLR3-IRF3 signaling pathway
N00563  TLR3-NFKB signaling pathway
N00564  HSV US3 to TLR3-NFKB signaling pathway
Drug target
Rintatolimod: D09661
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    7098 (TLR3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    7098 (TLR3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    7098 (TLR3)
   05161 Hepatitis B
    7098 (TLR3)
   05160 Hepatitis C
    7098 (TLR3)
   05168 Herpes simplex virus 1 infection
    7098 (TLR3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    7098 (TLR3)
   05165 Human papillomavirus infection
    7098 (TLR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hsa04054]
    7098 (TLR3)
   04090 CD molecules [BR:hsa04090]
    7098 (TLR3)
Pattern recognition receptors [BR:hsa04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   7098 (TLR3)
CD molecules [BR:hsa04090]
 Proteins
  7098 (TLR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_5 Tlr3_TMD LRR_9 LRR_6 TIR TIR_2 LRRNT LRRCT
Motif
Other DBs
NCBI-GeneID: 7098
NCBI-ProteinID: NP_003256
OMIM: 603029
HGNC: 11849
Ensembl: ENSG00000164342
Vega: OTTHUMG00000160345
Pharos: O15455(Tbio)
UniProt: O15455
Structure
PDB: 

Position
4q35.1
AA seq 904 aa AA seqDB search
MRQTLPCIYFWGGLLPFGMLCASSTTKCTVSHEVADCSHLKLTQVPDDLPTNITVLNLTH
NQLRRLPAANFTRYSQLTSLDVGFNTISKLEPELCQKLPMLKVLNLQHNELSQLSDKTFA
FCTNLTELHLMSNSIQKIKNNPFVKQKNLITLDLSHNGLSSTKLGTQVQLENLQELLLSN
NKIQALKSEELDIFANSSLKKLELSSNQIKEFSPGCFHAIGRLFGLFLNNVQLGPSLTEK
LCLELANTSIRNLSLSNSQLSTTSNTTFLGLKWTNLTMLDLSYNNLNVVGNDSFAWLPQL
EYFFLEYNNIQHLFSHSLHGLFNVRYLNLKRSFTKQSISLASLPKIDDFSFQWLKCLEHL
NMEDNDIPGIKSNMFTGLINLKYLSLSNSFTSLRTLTNETFVSLAHSPLHILNLTKNKIS
KIESDAFSWLGHLEVLDLGLNEIGQELTGQEWRGLENIFEIYLSYNKYLQLTRNSFALVP
SLQRLMLRRVALKNVDSSPSPFQPLRNLTILDLSNNNIANINDDMLEGLEKLEILDLQHN
NLARLWKHANPGGPIYFLKGLSHLHILNLESNGFDEIPVEVFKDLFELKIIDLGLNNLNT
LPASVFNNQVSLKSLNLQKNLITSVEKKVFGPAFRNLTELDMRFNPFDCTCESIAWFVNW
INETHTNIPELSSHYLCNTPPHYHGFPVRLFDTSSCKDSAPFELFFMINTSILLIFIFIV
LLIHFEGWRISFYWNVSVHRVLGFKEIDRQTEQFEYAAYIIHAYKDKDWVWEHFSSMEKE
DQSLKFCLEERDFEAGVFELEAIVNSIKRSRKIIFVITHHLLKDPLCKRFKVHHAVQQAI
EQNLDSIILVFLEEIPDYKLNHALCLRRGMFKSHCILNWPVQKERIGAFRHKLQVALGSK
NSVH
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atgagacagactttgccttgtatctacttttgggggggccttttgccctttgggatgctg
tgtgcatcctccaccaccaagtgcactgttagccatgaagttgctgactgcagccacctg
aagttgactcaggtacccgatgatctacccacaaacataacagtgttgaaccttacccat
aatcaactcagaagattaccagccgccaacttcacaaggtatagccagctaactagcttg
gatgtaggatttaacaccatctcaaaactggagccagaattgtgccagaaacttcccatg
ttaaaagttttgaacctccagcacaatgagctatctcaactttctgataaaacctttgcc
ttctgcacgaatttgactgaactccatctcatgtccaactcaatccagaaaattaaaaat
aatccctttgtcaagcagaagaatttaatcacattagatctgtctcataatggcttgtca
tctacaaaattaggaactcaggttcagctggaaaatctccaagagcttctattatcaaac
aataaaattcaagcgctaaaaagtgaagaactggatatctttgccaattcatctttaaaa
aaattagagttgtcatcgaatcaaattaaagagttttctccagggtgttttcacgcaatt
ggaagattatttggcctctttctgaacaatgtccagctgggtcccagccttacagagaag
ctatgtttggaattagcaaacacaagcattcggaatctgtctctgagtaacagccagctg
tccaccaccagcaatacaactttcttgggactaaagtggacaaatctcactatgctcgat
ctttcctacaacaacttaaatgtggttggtaacgattcctttgcttggcttccacaacta
gaatatttcttcctagagtataataatatacagcatttgttttctcactctttgcacggg
cttttcaatgtgaggtacctgaatttgaaacggtcttttactaaacaaagtatttccctt
gcctcactccccaagattgatgatttttcttttcagtggctaaaatgtttggagcacctt
aacatggaagataatgatattccaggcataaaaagcaatatgttcacaggattgataaac
ctgaaatacttaagtctatccaactcctttacaagtttgcgaactttgacaaatgaaaca
tttgtatcacttgctcattctcccttacacatactcaacctaaccaagaataaaatctca
aaaatagagagtgatgctttctcttggttgggccacctagaagtacttgacctgggcctt
aatgaaattgggcaagaactcacaggccaggaatggagaggtctagaaaatattttcgaa
atctatctttcctacaacaagtacctgcagctgactaggaactcctttgccttggtccca
agccttcaacgactgatgctccgaagggtggcccttaaaaatgtggatagctctccttca
ccattccagcctcttcgtaacttgaccattctggatctaagcaacaacaacatagccaac
ataaatgatgacatgttggagggtcttgagaaactagaaattctcgatttgcagcataac
aacttagcacggctctggaaacacgcaaaccctggtggtcccatttatttcctaaagggt
ctgtctcacctccacatccttaacttggagtccaacggctttgacgagatcccagttgag
gtcttcaaggatttatttgaactaaagatcatcgatttaggattgaataatttaaacaca
cttccagcatctgtctttaataatcaggtgtctctaaagtcattgaaccttcagaagaat
ctcataacatccgttgagaagaaggttttcgggccagctttcaggaacctgactgagtta
gatatgcgctttaatccctttgattgcacgtgtgaaagtattgcctggtttgttaattgg
attaacgagacccataccaacatccctgagctgtcaagccactacctttgcaacactcca
cctcactatcatgggttcccagtgagactttttgatacatcatcttgcaaagacagtgcc
ccctttgaactctttttcatgatcaataccagtatcctgttgatttttatctttattgta
cttctcatccactttgagggctggaggatatctttttattggaatgtttcagtacatcga
gttcttggtttcaaagaaatagacagacagacagaacagtttgaatatgcagcatatata
attcatgcctataaagataaggattgggtctgggaacatttctcttcaatggaaaaggaa
gaccaatctctcaaattttgtctggaagaaagggactttgaggcgggtgtttttgaacta
gaagcaattgttaacagcatcaaaagaagcagaaaaattatttttgttataacacaccat
ctattaaaagacccattatgcaaaagattcaaggtacatcatgcagttcaacaagctatt
gaacaaaatctggattccattatattggttttccttgaggagattccagattataaactg
aaccatgcactctgtttgcgaagaggaatgtttaaatctcactgcatcttgaactggcca
gttcagaaagaacggataggtgcctttcgtcataaattgcaagtagcacttggatccaaa
aactctgtacattaa

DBGET integrated database retrieval system