KEGG   Homo sapiens (human): 710
Entry
710               CDS       T01001                                 

Gene name
SERPING1, C1IN, C1INH, C1NH, HAE1, HAE2
Definition
(RefSeq) serpin family G member 1
  KO
K04001  C1 inhibitor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05133  Pertussis
Disease
H00106  Complement regulatory protein defects
H01006  Hereditary angioedema
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    710 (SERPING1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    710 (SERPING1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    710 (SERPING1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    710 (SERPING1)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I4: serpin family
   710 (SERPING1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   710 (SERPING1)
SSDB
Motif
Pfam: Serpin PT
Other DBs
NCBI-GeneID: 710
NCBI-ProteinID: NP_000053
OMIM: 606860
HGNC: 1228
Ensembl: ENSG00000149131
Vega: OTTHUMG00000150304
Pharos: P05155(Tbio)
UniProt: P05155 E9KL26
Structure
PDB: 
5DU3 2OAY 5DUQ

Position
11q12.1
AA seq 500 aa
MASRLTLLTLLLLLLAGDRASSNPNATSSSSQDPESLQDRGEGKVATTVISKMLFVEPIL
EVSSLPTTNSTTNSATKITANTTDEPTTQPTTEPTTQPTIQPTQPTTQLPTDSPTQPTTG
SFCPGPVTLCSDLESHSTEAVLGDALVDFSLKLYHAFSAMKKVETNMAFSPFSIASLLTQ
VLLGAGENTKTNLESILSYPKDFTCVHQALKGFTTKGVTSVSQIFHSPDLAIRDTFVNAS
RTLYSSSPRVLSNNSDANLELINTWVAKNTNNKISRLLDSLPSDTRLVLLNAIYLSAKWK
TTFDPKKTRMEPFHFKNSVIKVPMMNSKKYPVAHFIDQTLKAKVGQLQLSHNLSLVILVP
QNLKHRLEDMEQALSPSVFKAIMEKLEMSKFQPTLLTLPRIKVTTSQDMLSIMEKLEFFD
FSYDLNLCGLTEDPDLQVSAMQHQTVLELTETGVEAAAASAISVARTLLVFEVQQPFLFV
LWDQQHKFPVFMGRVYDPRA
NT seq 1503 nt   +upstreamnt  +downstreamnt
atggcctccaggctgaccctgctgaccctcctgctgctgctgctggctggggatagagcc
tcctcaaatccaaatgctaccagctccagctcccaggatccagagagtttgcaagacaga
ggcgaagggaaggtcgcaacaacagttatctccaagatgctattcgttgaacccatcctg
gaggtttccagcttgccgacaaccaactcaacaaccaattcagccaccaaaataacagct
aataccactgatgaacccaccacacaacccaccacagagcccaccacccaacccaccatc
caacccacccaaccaactacccagctcccaacagattctcctacccagcccactactggg
tccttctgcccaggacctgttactctctgctctgacttggagagtcattcaacagaggcc
gtgttgggggatgctttggtagatttctccctgaagctctaccacgccttctcagcaatg
aagaaggtggagaccaacatggccttttccccattcagcatcgccagcctccttacccag
gtcctgctcggggctggggagaacaccaaaacaaacctggagagcatcctctcttacccc
aaggacttcacctgtgtccaccaggccctgaagggcttcacgaccaaaggtgtcacctca
gtctctcagatcttccacagcccagacctggccataagggacacctttgtgaatgcctct
cggaccctgtacagcagcagccccagagtcctaagcaacaacagtgacgccaacttggag
ctcatcaacacctgggtggccaagaacaccaacaacaagatcagccggctgctagacagt
ctgccctccgatacccgccttgtcctcctcaatgctatctacctgagtgccaagtggaag
acaacatttgatcccaagaaaaccagaatggaaccctttcacttcaaaaactcagttata
aaagtgcccatgatgaatagcaagaagtaccctgtggcccatttcattgaccaaactttg
aaagccaaggtggggcagctgcagctctcccacaatctgagtttggtgatcctggtaccc
cagaacctgaaacatcgtcttgaagacatggaacaggctctcagcccttctgttttcaag
gccatcatggagaaactggagatgtccaagttccagcccactctcctaacactaccccgc
atcaaagtgacgaccagccaggatatgctctcaatcatggagaaattggaattcttcgat
ttttcttatgaccttaacctgtgtgggctgacagaggacccagatcttcaggtttctgcg
atgcagcaccagacagtgctggaactgacagagactggggtggaggcggctgcagcctcc
gccatctctgtggcccgcaccctgctggtctttgaagtgcagcagcccttcctcttcgtg
ctctgggaccagcagcacaagttccctgtcttcatggggcgagtatatgaccccagggcc
tga

DBGET integrated database retrieval system