KEGG   Homo sapiens (human): 7102Help
Entry
7102              CDS       T01001                                 

Gene name
TSPAN7, A15, CCG-B7, CD231, DXS1692E, MRX58, MXS1, TALLA-1, TM4SF2, TM4SF2b
Definition
(RefSeq) tetraspanin 7
  KO
K06571  tetraspanin-7
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Network
N00137  EWSR1-WT1 fusion to transcriptional activation
Disease
H00480  X-linked mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    7102 (TSPAN7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7102 (TSPAN7)
   04090 CD molecules [BR:hsa04090]
    7102 (TSPAN7)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   7102 (TSPAN7)
CD molecules [BR:hsa04090]
 Proteins
  7102 (TSPAN7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tetraspanin Endonuclease_1
Motif
Other DBs
NCBI-GeneID: 7102
NCBI-ProteinID: NP_004606
OMIM: 300096
HGNC: 11854
Ensembl: ENSG00000156298
Vega: OTTHUMG00000024090
Pharos: P41732(Tbio)
UniProt: P41732
Position
Xp11.4
AA seq 249 aa AA seqDB search
MASRRMETKPVITCLKTLLIIYSFVFWITGVILLAVGVWGKLTLGTYISLIAENSTNAPY
VLIGTGTTIVVFGLFGCFATCRGSPWMLKLYAMFLSLVFLAELVAGISGFVFRHEIKDTF
LRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETD
CNPQDLHNLTVAATKVNQKGCYDLVTSFMETNMGIIAGVAFGIAFSQLIGMLLACCLSRF
ITANQYEMV
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgaggagaatggagaccaaacctgtgataacctgtctcaaaaccctcctcatc
atctactccttcgtcttctggatcactggggtgatcctgctggctgttggagtctggggc
aaacttactctgggcacctatatctcccttattgccgagaactccacaaatgctccctat
gtgctcatcggaactggcaccactattgttgtctttggcctgtttggatgctttgctaca
tgtcgtggtagcccatggatgctgaaactgtatgccatgtttctgtccctggtgttcctg
gctgagctcgtagctggcatttcagggtttgtgtttcgtcatgagatcaaggacaccttc
ctgaggacttacacggacgctatgcagacttacaatggcaatgatgagaggagccgggca
gtggaccatgtgcagcgcagcctgagctgctgtggtgtgcagaactacaccaactggagc
accagcccctacttcctggagcatggcatcccccccagctgctgcatgaacgaaactgat
tgtaatccccaggatctacacaatctgactgtggccgccaccaaagttaaccagaagggt
tgttatgatctggtaactagtttcatggagactaacatgggaatcatcgctggagtggcg
tttggaatcgcattctcccagttaattggcatgctgctggcctgctgtctgtcccggttc
atcacggccaatcagtatgagatggtgtaa

DBGET integrated database retrieval system