KEGG   Homo sapiens (human): 7106
Entry
7106              CDS       T01001                                 
Symbol
TSPAN4, NAG-2, NAG2, TETRASPAN, TM4SF7, TSPAN-4
Name
(RefSeq) tetraspanin 4
  KO
K17294  tetraspanin-4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7106 (TSPAN4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   7106 (TSPAN4)
SSDB
Motif
Pfam: Tetraspanin CD20
Other DBs
NCBI-GeneID: 7106
NCBI-ProteinID: NP_001020405
OMIM: 602644
HGNC: 11859
Ensembl: ENSG00000214063
UniProt: O14817
Position
11:842852..867111
AA seq 238 aa
MARACLQAVKYLMFAFNLLFWLGGCGVLGVGIWLAATQGSFATLSSSFPSLSAANLLIIT
GAFVMAIGFVGCLGAIKENKCLLLTFFLLLLLVFLLEATIAILFFAYTDKIDRYAQQDLK
KGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDWFEVYNATRVPDSCCLEFSESCGLH
APGTWWKAPCYETVKVWLQENLLAVGIFGLCTALVQILGLTFAMTMYCQVVKADTYCA
NT seq 717 nt   +upstreamnt  +downstreamnt
atggcgcgcgcctgcctccaggccgtcaagtacctcatgttcgccttcaacctgctcttc
tggctgggaggctgtggcgtgctgggtgtcggcatctggctggccgccacacaggggagc
ttcgccacgctgtcctcttccttcccgtccctgtcggctgccaacttgctcatcatcacc
ggcgcctttgtcatggccatcggcttcgtgggctgcctgggtgccatcaaggagaacaag
tgcctcctgctcactttcttcctgctgctgctgctggtgttcctgctggaggccaccatc
gccatcctcttcttcgcctacacggacaagattgacaggtatgcccagcaagacctgaag
aaaggcttgcacctgtacggcacgcagggcaacgtgggcctcaccaacgcctggagcatc
atccagaccgacttccgctgctgtggcgtctccaactacactgactggttcgaggtgtac
aacgccacgcgggtacctgactcctgctgcttggagttcagtgagagctgtgggctgcac
gcccccggcacctggtggaaggcgccgtgctacgagacggtgaaggtgtggcttcaggag
aacctgctggctgtgggcatctttgggctgtgcacggcgctggtgcagatcctgggcctg
accttcgccatgaccatgtactgccaagtggtcaaggcagacacctactgcgcgtag

DBGET integrated database retrieval system