KEGG   Homo sapiens (human): 7108
Entry
7108              CDS       T01001                                 

Gene name
TM7SF2, ANG1, C14SR, DHCR14A, NET47
Definition
(RefSeq) transmembrane 7 superfamily member 2
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00100  Steroid biosynthesis
hsa01100  Metabolic pathways
Module
hsa_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    7108 (TM7SF2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     7108 (TM7SF2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 7108
NCBI-ProteinID: NP_003264
OMIM: 603414
HGNC: 11863
Ensembl: ENSG00000149809
Vega: OTTHUMG00000165603
Pharos: O76062(Tbio)
UniProt: O76062 A0A024R577
Position
11q13.1
AA seq 418 aa
MAPTQGPRAPLEFGGPLGAAALLLLLPATMFHLLLAARSGPARLLGPPASLPGLEVLWSP
RALLLWLAWLGLQAALYLLPARKVAEGQELKDKSRLRYPINGFQALVLTALLVGLGMSAG
LPLGALPEMLLPLAFVATLTAFIFSLFLYMKAQVAPVSALAPGGNSGNPIYDFFLGRELN
PRICFFDFKYFCELRPGLIGWVLINLALLMKEAELRGSPSLAMWLVNGFQLLYVGDALWH
EEAVLTTMDITHDGFGFMLAFGDMAWVPFTYSLQAQFLLHHPQPLGLPMASVICLINATG
YYIFRGANSQKNTFRKNPSDPRVAGLETISTATGRKLLVSGWWGMVRHPNYLGDLIMALA
WSLPCGVSHLLPYFYLLYFTALLVHREARDERQCLQKYGLAWQEYCRRVPYRIMPYIY
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggcccccactcagggcccccgggccccgctggaattcggagggcccctgggcgccgcg
gctctgctactgctgctgcccgccaccatgttccacctgctcctggcggcccgttcgggc
cccgcgcgcctgctgggtccacccgcgtccctgccggggctggaggtgctgtggagccca
cgggcgctgctgctgtggctcgcctggctcggcctgcaggcggcgctctacctactgccg
gcgcgcaaggtggccgaggggcaggaattgaaggacaagagtcgcctgcgctatcctatt
aacggcttccaggccctggtgctgacagccctgttggtggggctggggatgtcagcgggg
ctgcctctgggggcgctcccggaaatgctcctgcccttggcgtttgtcgccaccctcacc
gctttcatcttcagcctctttctctacatgaaggcgcaggtagccccagtttcggccctg
gcacctggggggaactcaggcaatccgatttacgacttttttctgggacgagagctcaac
cctcgtatctgtttcttcgacttcaaatatttctgtgaactgcgacccggcctcatcggc
tgggtcctcatcaacctggccctgttgatgaaggaggcagagcttcgaggcagtccctca
ctggccatgtggctggtcaatggcttccagttgctctacgtgggtgatgccctctggcac
gaggaggccgtcctcaccaccatggatatcacacatgacgggtttggcttcatgctggcg
tttggggacatggcctgggtgcccttcacctacagcctgcaggcccagttcctgctgcac
cacccgcagcccctggggttgcccatggcctctgtcatctgcctcatcaatgctactggt
tactacatcttccgtggggcgaattcccagaaaaacactttccgaaagaatccttctgac
cccagagtggctgggcttgagaccatctctacagccacagggcggaaactgctggtgtct
gggtggtggggtatggtccgccatcccaactatcttggagacctcatcatggctctggct
tggtccttgccctgcggggtgtcacacctgctgccctacttctacctcctctacttcacc
gcgctgctggtgcaccgtgaggcccgggatgagcggcagtgcctgcagaagtacggcctg
gcctggcaggagtactgccggcgtgtgccttaccgcatcatgccctacatctactga

DBGET integrated database retrieval system