KEGG   Homo sapiens (human): 7112Help
Entry
7112              CDS       T01001                                 

Gene name
TMPO, CMD1T, LAP2, LEMD4, PRO0868, TP
Definition
(RefSeq) thymopoietin
Organism
hsa  Homo sapiens (human)
  ELEMENT   N00330  BANF1-mediated nuclear assembly
Disease
H00294  Dilated cardiomyopathy
SSDB OrthologParalogGFIT
Motif
Pfam: Thymopoietin LEM TNFR_16_TM
Motif
Other DBs
NCBI-GeneID: 7112
NCBI-ProteinID: NP_001027454
OMIM: 188380
HGNC: 11875
Ensembl: ENSG00000120802
Vega: OTTHUMG00000170210
Pharos: P42167(Tbio)
UniProt: P42167 A0A024RBE7 Q59G12
Structure
PDB: 

Position
12q23.1
AA seq 454 aa AA seqDB search
MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLPAGTNSK
GPPDFSSDEEREPTPVLGSGAAAAGRSRAAVGRKATKKTDKPRQEDKDDLDVTELTNEDL
LDQLVKYGVNPGPIVGTTRKLYEKKLLKLREQGTESRSSTPLPTISSSAENTRQNGSNDS
DRYSDNEEDSKIELKLEKREPLKGRAKTPVTLKQRRVEHNQSYSQAGITETEWTSGSSKG
GPLQALTRESTRGSRRTPRKRVETSEHFRIDGPVISESTPIAETIMASSNESLVVNRVTG
NFKHASPILPITEFSDIPRRAPKKPLTRAEVGEKTEERRVERDILKEMFPYEASTPTGIS
ASCRRPIKGAAGRPLELSDFRMEESFSSKYVPKYVPLADVKSEKTKKGRSIPVWIKILLF
VVVAVFLFLVYQAMETNQVNPFSNFLHVDPRKSN
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgccggagttcctggaagacccctcggtcctgacaaaagacaagttgaagagtgagttg
gtcgccaacaatgtgacgctgccggccggggagcagcgcaaagacgtgtacgtccagctc
tacctgcagcacctcacggctcgcaaccggccgccgctccccgccggcaccaacagcaag
gggcccccggacttctccagtgacgaagagcgcgagcccaccccggtcctcggctctggg
gccgccgccgcgggccggagccgagcagccgtcggcaggaaagccacaaaaaaaactgat
aaacccagacaagaagataaagatgatctagatgtaacagagctcactaatgaagatctt
ttggatcagcttgtgaaatacggagtgaatcctggtcctattgtgggaacaaccaggaag
ctatatgagaaaaagcttttgaaactgagggaacaaggaacagaatcaagatcttctact
cctctgccaacaatttcttcttcagcagaaaatacaaggcagaatggaagtaatgattct
gacagatacagtgacaatgaagaagactctaaaatagagctcaagcttgagaagagagaa
ccactaaagggcagagcaaagactccagtaacactcaagcaaagaagagttgagcacaat
cagagctattctcaagctggaataactgagactgaatggacaagtggatcttcaaaaggc
ggacctctgcaggcattaactagggaatctacaagagggtcaagaagaactccaaggaaa
agggtggaaacttcagaacattttcgtatagatggtccagtaatttcagagagtactccc
atagctgaaactataatggcttcaagcaacgaatccttagttgtcaatagggtgactgga
aatttcaagcatgcatctcctattctgccaatcactgaattctcagacatacccagaaga
gcaccaaagaaaccattgacaagagctgaagtgggagaaaaaacagaggaaagaagagta
gaaagggatattcttaaggaaatgttcccctatgaagcatctacaccaacaggaattagt
gctagttgccgcagaccaatcaaaggggctgcaggccggccattagaactcagtgatttc
aggatggaggagtctttttcatctaaatatgttcctaagtatgttcccttggcagatgtc
aagtcagaaaagacaaaaaagggacgctccattcccgtatggataaaaattttgctgttt
gttgttgtggcagtttttttgtttttggtctatcaagctatggaaaccaaccaagtaaat
cccttctctaattttcttcatgttgaccctagaaaatccaactga

DBGET integrated database retrieval system