KEGG   Homo sapiens (human): 7114Help
Entry
7114              CDS       T01001                                 

Gene name
TMSB4X, FX, PTMB4, TB4X, TMSB4
Definition
(RefSeq) thymosin beta 4 X-linked
  KO
K05764  thymosin, beta 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    7114 (TMSB4X)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Thymosin
     7114 (TMSB4X)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thymosin WH2 DUF4522
Motif
Other DBs
NCBI-GeneID: 7114
NCBI-ProteinID: NP_066932
OMIM: 300159
HGNC: 11881
Ensembl: ENSG00000205542
Vega: OTTHUMG00000021144
Pharos: P62328(Tbio)
UniProt: P62328 Q0P5T0 A2VCK8
Structure
PDB: 

Position
Xp22.2
AA seq 44 aa AA seqDB search
MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
NT seq 135 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaaacccgatatggctgagatcgagaaattcgataagtcgaaactgaagaag
acagagacgcaagagaaaaatccactgccttccaaagaaacgattgaacaggagaagcaa
gcaggcgaatcgtaa

DBGET integrated database retrieval system