KEGG   Homo sapiens (human): 7114
Entry
7114              CDS       T01001                                 

Gene name
TMSB4X, FX, PTMB4, TB4X, TMSB4
Definition
(RefSeq) thymosin beta 4 X-linked
  KO
K05764  thymosin, beta 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    7114 (TMSB4X)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    7114 (TMSB4X)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Thymosin
     7114 (TMSB4X)
SSDB
Motif
Pfam: Thymosin WH2 DUF4522
Other DBs
NCBI-GeneID: 7114
NCBI-ProteinID: NP_066932
OMIM: 300159
HGNC: 11881
Ensembl: ENSG00000205542
Vega: OTTHUMG00000021144
Pharos: P62328(Tbio)
UniProt: P62328 A2VCK8 Q0P5T0
Structure
PDB: 
4PL8

Position
Xp22.2
AA seq 44 aa
MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
NT seq 135 nt   +upstreamnt  +downstreamnt
atgtctgacaaacccgatatggctgagatcgagaaattcgataagtcgaaactgaagaag
acagagacgcaagagaaaaatccactgccttccaaagaaacgattgaacaggagaagcaa
gcaggcgaatcgtaa

KEGG   Homo sapiens (human): 9087
Entry
9087              CDS       T01001                                 

Gene name
TMSB4Y, TB4Y
Definition
(RefSeq) thymosin beta 4 Y-linked
  KO
K05764  thymosin, beta 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    9087 (TMSB4Y)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    9087 (TMSB4Y)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Thymosin
     9087 (TMSB4Y)
SSDB
Motif
Pfam: Thymosin WH2
Other DBs
NCBI-GeneID: 9087
NCBI-ProteinID: NP_004193
OMIM: 400017
HGNC: 11882
Ensembl: ENSG00000154620
Vega: OTTHUMG00000036366
Pharos: O14604(Tdark)
CPD: C16066
UniProt: O14604
Position
Yq11.221
AA seq 44 aa
MSDKPGMAEIEKFDKSKLKKTETQEKNPLSSKETIEQERQAGES
NT seq 135 nt   +upstreamnt  +downstreamnt
atgtctgacaaacctggtatggctgagatcgagaaattcgataagtcgaaactgaagaag
acagaaacgcaagagaagaatccattgtcttccaaagaaactatcgaacaggagaggcaa
gcaggcgaatcttaa

DBGET integrated database retrieval system