KEGG   Homo sapiens (human): 712Help
Entry
712               CDS       T01001                                 

Gene name
C1QA
Definition
(RefSeq) complement C1q A chain
  KO
K03986  complement C1q subcomponent subunit A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05020  Prion diseases
hsa05133  Pertussis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05150  Staphylococcus aureus infection
hsa05322  Systemic lupus erythematosus
Disease
H00102  Classic complement pathway component defects
H01357  Allergic contact dermatitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    712 (C1QA)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    712 (C1QA)
  09164 Neurodegenerative disease
   05020 Prion diseases
    712 (C1QA)
  09171 Infectious disease: bacterial
   05133 Pertussis
    712 (C1QA)
   05150 Staphylococcus aureus infection
    712 (C1QA)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    712 (C1QA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    712 (C1QA)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    712 (C1QA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C1q Collagen TNF
Motif
Other DBs
NCBI-GeneID: 712
NCBI-ProteinID: NP_001334394
OMIM: 120550
HGNC: 1241
Ensembl: ENSG00000173372
Vega: OTTHUMG00000002893
Pharos: P02745(Tbio)
UniProt: P02745 A0A024RAG6
Structure
PDB: 

Position
1p36.12
AA seq 245 aa AA seqDB search
MEGPRGWLVLCVLAISLASMVTEDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIR
TGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAI
RRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSR
GQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFL
IFPSA
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggagggtccccggggatggctggtgctctgtgtgctggccatatcgctggcctctatg
gtgaccgaggacttgtgccgagcaccagacgggaagaaaggggaggcaggaagacctggc
agacgggggcggccaggcctcaagggggagcaaggggagccgggggcccctggcatccgg
acaggcatccaaggccttaaaggagaccagggggaacctgggccctctggaaaccccggc
aaggtgggctacccagggcccagcggccccctcggagcccgtggcatcccgggaattaaa
ggcaccaagggcagcccaggaaacatcaaggaccagccgaggccagccttctccgccatt
cggcggaaccccccaatggggggcaacgtggtcatcttcgacacggtcatcaccaaccag
gaagaaccgtaccagaaccactccggccgattcgtctgcactgtacccggctactactac
ttcaccttccaggtgctgtcccagtgggaaatctgcctgtccatcgtctcctcctcaagg
ggccaggtccgacgctccctgggcttctgtgacaccaccaacaaggggctcttccaggtg
gtgtcagggggcatggtgcttcagctgcagcagggtgaccaggtctgggttgaaaaagac
cccaaaaagggtcacatttaccagggctctgaggccgacagcgtcttcagcggcttcctc
atcttcccatctgcctga

KEGG   Homo sapiens (human): 713Help
Entry
713               CDS       T01001                                 

Gene name
C1QB
Definition
(RefSeq) complement C1q B chain
  KO
K03987  complement C1q subcomponent subunit B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05020  Prion diseases
hsa05133  Pertussis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05150  Staphylococcus aureus infection
hsa05322  Systemic lupus erythematosus
Disease
H00102  Classic complement pathway component defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    713 (C1QB)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    713 (C1QB)
  09164 Neurodegenerative disease
   05020 Prion diseases
    713 (C1QB)
  09171 Infectious disease: bacterial
   05133 Pertussis
    713 (C1QB)
   05150 Staphylococcus aureus infection
    713 (C1QB)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    713 (C1QB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    713 (C1QB)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    713 (C1QB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C1q Collagen BclA_C
Motif
Other DBs
NCBI-GeneID: 713
NCBI-ProteinID: NP_000482
OMIM: 120570
HGNC: 1242
Ensembl: ENSG00000173369
Vega: OTTHUMG00000002896
Pharos: P02746(Tbio)
UniProt: P02746 A0A024RAB9
Structure
PDB: 

Position
1p36.12
AA seq 253 aa AA seqDB search
MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKG
EKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQ
KIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNL
CVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANS
IFSGFLLFPDMEA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgaagatcccatggggcagcatcccagtactgatgttgctcctgctcctgggc
ctaatcgatatctcccaggcccagctcagctgcaccgggcccccagccatccctggcatc
ccgggtatccctgggacacctggccccgatggccaacctgggaccccagggataaaagga
gagaaagggcttccagggctggctggagaccatggtgagttcggagagaagggagaccca
gggattcctgggaatccaggaaaagtcggccccaagggccccatgggccctaaaggtggc
ccaggggcccctggagccccaggccccaaaggtgaatcgggagactacaaggccacccag
aaaatcgccttctctgccacaagaaccatcaacgtccccctgcgccgggaccagaccatc
cgcttcgaccacgtgatcaccaacatgaacaacaattatgagccccgcagtggcaagttc
acctgcaaggtgcccggtctctactacttcacctaccacgccagctctcgagggaacctg
tgcgtgaacctcatgcgtggccgggagcgtgcacagaaggtggtcaccttctgtgactat
gcctacaacaccttccaggtcaccaccggtggcatggtcctcaagctggagcagggggag
aacgtcttcctgcaggccaccgacaagaactcactactgggcatggagggtgccaacagc
atcttttccgggttcctgctctttccagatatggaggcctga

KEGG   Homo sapiens (human): 714Help
Entry
714               CDS       T01001                                 

Gene name
C1QC, C1Q-C, C1QG
Definition
(RefSeq) complement C1q C chain
  KO
K03988  complement C1q subcomponent subunit C
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05020  Prion diseases
hsa05133  Pertussis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05150  Staphylococcus aureus infection
hsa05322  Systemic lupus erythematosus
Disease
H00102  Classic complement pathway component defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    714 (C1QC)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    714 (C1QC)
  09164 Neurodegenerative disease
   05020 Prion diseases
    714 (C1QC)
  09171 Infectious disease: bacterial
   05133 Pertussis
    714 (C1QC)
   05150 Staphylococcus aureus infection
    714 (C1QC)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    714 (C1QC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    714 (C1QC)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    714 (C1QC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C1q Collagen BclA_C
Motif
Other DBs
NCBI-GeneID: 714
NCBI-ProteinID: NP_001107573
OMIM: 120575
HGNC: 1245
Ensembl: ENSG00000159189
Vega: OTTHUMG00000002891
Pharos: P02747(Tbio)
UniProt: P02747 A0A024RAA7
Structure
PDB: 

Position
1p36.12
AA seq 245 aa AA seqDB search
MDVGPSSLPHLGLKLLLLLLLLPLRGQANTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEP
GIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQS
VFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCV
LLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGF
LLFPD
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggacgtggggcccagctccctgccccaccttgggctgaagctgctgctgctcctgctg
ctgctgcccctcaggggccaagccaacacaggctgctacgggatcccagggatgcccggc
ctgcccggggcaccagggaaggatgggtacgacggactgccggggcccaagggggagcca
ggaatcccagccattcccgggatccgaggacccaaagggcagaagggagaacccggctta
cccggccatcctgggaaaaatggccccatgggaccccctgggatgccaggggtgcccggc
cccatgggcatccctggagagccaggtgaggagggcagatacaagcagaaattccagtca
gtgttcacggtcactcggcagacccaccagccccctgcacccaacagcctgatcagattc
aacgcggtcctcaccaacccgcagggagattatgacacgagcactggcaagttcacctgc
aaagtccccggcctctactactttgtctaccacgcgtcgcatacagccaacctgtgcgtg
ctgctgtaccgcagcggcgtcaaagtggtcaccttctgtggccacacgtccaaaaccaat
caggtcaactcgggcggtgtgctgctgaggttgcaggtgggcgaggaggtgtggctggct
gtcaatgactactacgacatggtgggcatccagggctctgacagcgtcttctccggcttc
ctgctcttccccgactag

DBGET integrated database retrieval system