KEGG   Homo sapiens (human): 7123
Entry
7123              CDS       T01001                                 
Symbol
CLEC3B, TN, TNA
Name
(RefSeq) C-type lectin domain family 3 member B
  KO
K17520  C-type lectin domain family 3 member B
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:hsa04091]
    7123 (CLEC3B)
Lectins [BR:hsa04091]
 C-Type lectins
  Group 9: Tetranectin
   7123 (CLEC3B)
SSDB
Motif
Pfam: Lectin_C Chordopox_A33R
Other DBs
NCBI-GeneID: 7123
NCBI-ProteinID: NP_003269
OMIM: 187520
HGNC: 11891
Ensembl: ENSG00000163815
Pharos: P05452(Tbio)
UniProt: P05452
Structure
Position
3:45026303..45036071
AA seq 202 aa
MELWGAYLLLCLFSLLTQVTTEPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVAL
LKEQQALQTVCLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLGTPQTGSENDALYEY
LRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAA
NGKWFDKRCRDQLPYICQFGIV
NT seq 609 nt   +upstreamnt  +downstreamnt
atggagctctggggggcctacctcctcctctgcctcttctccctcctgacccaggtcacc
accgagccaccaacccagaagcccaagaagattgtaaatgccaagaaagatgttgtgaac
acaaagatgtttgaggagctcaagagccgtctggacaccctggcccaggaggtggccctg
ctgaaggagcagcaggccctgcagacggtctgcctgaaggggaccaaggtgcacatgaaa
tgctttctggccttcacccagacgaagaccttccacgaggccagcgaggactgcatctcg
cgcgggggcaccctgggcacccctcagactggctcggagaacgacgccctgtatgagtac
ctgcgccagagcgtgggcaacgaggccgagatctggctgggcctcaacgacatggcggcc
gagggcacctgggtggacatgaccggcgcccgcatcgcctacaagaactgggagactgag
atcaccgcgcaacccgatggcggcaagaccgagaactgcgcggtcctgtcaggcgcggcc
aacggcaagtggttcgacaagcgctgccgcgatcagctgccctacatctgccagttcggg
atcgtgtag

DBGET integrated database retrieval system