KEGG   Homo sapiens (human): 7124Help
Entry
7124              CDS       T01001                                 

Gene name
TNF, DIF, TNF-alpha, TNFA, TNFSF2, TNLG1F
Definition
(RefSeq) tumor necrosis factor
  KO
K03156  tumor necrosis factor superfamily, member 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa01523  Antifolate resistance
hsa04010  MAPK signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04064  NF-kappa B signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04150  mTOR signaling pathway
hsa04210  Apoptosis
hsa04217  Necroptosis
hsa04350  TGF-beta signaling pathway
hsa04380  Osteoclast differentiation
hsa04612  Antigen processing and presentation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04640  Hematopoietic cell lineage
hsa04650  Natural killer cell mediated cytotoxicity
hsa04657  IL-17 signaling pathway
hsa04660  T cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04668  TNF signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04930  Type II diabetes mellitus
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04940  Type I diabetes mellitus
hsa05010  Alzheimer disease
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05143  African trypanosomiasis
hsa05144  Malaria
hsa05145  Toxoplasmosis
hsa05146  Amoebiasis
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05205  Proteoglycans in cancer
hsa05310  Asthma
hsa05321  Inflammatory bowel disease (IBD)
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05414  Dilated cardiomyopathy (DCM)
hsa05418  Fluid shear stress and atherosclerosis
Network
N00145  Extrinsic apoptotic pathway
N00151  TNF-NFKB signaling pathway
N00374  TNF-IRF1 signaling pathway
N00435  TLR2/4-NFKB signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00437  HIV Vpu to TLR2/4-NFKB signaling pathway
N00439  HIV Nef to TLR2/4-MAPK signaling pathway
N00444  TNF-p38 signaling pathway
N00446  TNF-JNK signaling pathway
N00466  EBV BPLF1 to TLR2/4-NFKB signaling pathway
N00467  EBV BPLF1 to TLR2/4-NFKB signaling pathway
N00468  EBV BPLF1 to TLR2/4-NFKB signaling pathway
 » show all
Disease
H00079  Asthma
H00080  Systemic lupus erythematosus
H00083  Allograft rejection
H00084  Graft-versus-host disease
Drug target
Adalimumab: D02597
Afelimomab: D07436
Certolizumab pegol: D03441
Etanercept: D00742
Golimumab: D04358
Infliximab: D02598
Lenalidomide (DG00744): D04687 D09813
Lenercept: D04690
Nerelimomab: D05146
Onercept: D05263
Ozoralizumab: D09944
Pegsunercept: D05393
Pirfenidone: D01583
Placulumab: D10320
Pomalidomide: D08976
Thalidomide: D00754
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    7124 (TNF)
   04350 TGF-beta signaling pathway
    7124 (TNF)
   04064 NF-kappa B signaling pathway
    7124 (TNF)
   04668 TNF signaling pathway
    7124 (TNF)
   04071 Sphingolipid signaling pathway
    7124 (TNF)
   04150 mTOR signaling pathway
    7124 (TNF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7124 (TNF)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    7124 (TNF)
   04217 Necroptosis
    7124 (TNF)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    7124 (TNF)
   04620 Toll-like receptor signaling pathway
    7124 (TNF)
   04621 NOD-like receptor signaling pathway
    7124 (TNF)
   04622 RIG-I-like receptor signaling pathway
    7124 (TNF)
   04625 C-type lectin receptor signaling pathway
    7124 (TNF)
   04650 Natural killer cell mediated cytotoxicity
    7124 (TNF)
   04612 Antigen processing and presentation
    7124 (TNF)
   04660 T cell receptor signaling pathway
    7124 (TNF)
   04657 IL-17 signaling pathway
    7124 (TNF)
   04664 Fc epsilon RI signaling pathway
    7124 (TNF)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    7124 (TNF)
  09158 Development
   04380 Osteoclast differentiation
    7124 (TNF)
 09160 Human Diseases
  09161 Cancers: Overview
   05205 Proteoglycans in cancer
    7124 (TNF)
  09163 Immune diseases
   05310 Asthma
    7124 (TNF)
   05322 Systemic lupus erythematosus
    7124 (TNF)
   05323 Rheumatoid arthritis
    7124 (TNF)
   05321 Inflammatory bowel disease (IBD)
    7124 (TNF)
   05330 Allograft rejection
    7124 (TNF)
   05332 Graft-versus-host disease
    7124 (TNF)
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    7124 (TNF)
   05014 Amyotrophic lateral sclerosis (ALS)
    7124 (TNF)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    7124 (TNF)
   05410 Hypertrophic cardiomyopathy (HCM)
    7124 (TNF)
   05414 Dilated cardiomyopathy (DCM)
    7124 (TNF)
  09167 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    7124 (TNF)
   04940 Type I diabetes mellitus
    7124 (TNF)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    7124 (TNF)
   04931 Insulin resistance
    7124 (TNF)
   04933 AGE-RAGE signaling pathway in diabetic complications
    7124 (TNF)
  09171 Infectious diseases: Bacterial
   05133 Pertussis
    7124 (TNF)
   05134 Legionellosis
    7124 (TNF)
   05152 Tuberculosis
    7124 (TNF)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    7124 (TNF)
   05170 Human immunodeficiency virus 1 infection
    7124 (TNF)
   05164 Influenza A
    7124 (TNF)
   05161 Hepatitis B
    7124 (TNF)
   05160 Hepatitis C
    7124 (TNF)
   05168 Herpes simplex infection
    7124 (TNF)
   05163 Human cytomegalovirus infection
    7124 (TNF)
   05169 Epstein-Barr virus infection
    7124 (TNF)
   05165 Human papillomavirus infection
    7124 (TNF)
  09174 Infectious diseases: Parasitic
   05146 Amoebiasis
    7124 (TNF)
   05144 Malaria
    7124 (TNF)
   05145 Toxoplasmosis
    7124 (TNF)
   05140 Leishmaniasis
    7124 (TNF)
   05142 Chagas disease (American trypanosomiasis)
    7124 (TNF)
   05143 African trypanosomiasis
    7124 (TNF)
  09176 Drug resistance: Antineoplastic
   01523 Antifolate resistance
    7124 (TNF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    7124 (TNF)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7124 (TNF)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Tumor necrosis fators
   7124 (TNF)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Cytokines
   7124 (TNF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 7124
NCBI-ProteinID: NP_000585
OMIM: 191160
HGNC: 11892
Ensembl: ENSG00000232810
Vega: OTTHUMG00000031194
Pharos: P01375(Tclin)
UniProt: P01375 Q5STB3
Structure
PDB: 

Position
6p21.33
AA seq 233 aa AA seqDB search
MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQR
EEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELR
DNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE
TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgaaagcatgatccgggacgtggagctggccgaggaggcgctccccaagaag
acaggggggccccagggctccaggcggtgcttgttcctcagcctcttctccttcctgatc
gtggcaggcgccaccacgctcttctgcctgctgcactttggagtgatcggcccccagagg
gaagagttccccagggacctctctctaatcagccctctggcccaggcagtcagatcatct
tctcgaaccccgagtgacaagcctgtagcccatgttgtagcaaaccctcaagctgagggg
cagctccagtggctgaaccgccgggccaatgccctcctggccaatggcgtggagctgaga
gataaccagctggtggtgccatcagagggcctgtacctcatctactcccaggtcctcttc
aagggccaaggctgcccctccacccatgtgctcctcacccacaccatcagccgcatcgcc
gtctcctaccagaccaaggtcaacctcctctctgccatcaagagcccctgccagagggag
accccagagggggctgaggccaagccctggtatgagcccatctatctgggaggggtcttc
cagctggagaagggtgaccgactcagcgctgagatcaatcggcccgactatctcgacttt
gccgagtctgggcaggtctactttgggatcattgccctgtga

DBGET integrated database retrieval system