KEGG   Homo sapiens (human): 7130
Entry
7130              CDS       T01001                                 

Gene name
TNFAIP6, TSG-6, TSG6
Definition
(RefSeq) TNF alpha induced protein 6
  KO
K19018  tumor necrosis factor-inducible gene 6 protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7130 (TNFAIP6)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   7130 (TNFAIP6)
SSDB
Motif
Pfam: CUB Xlink
Other DBs
NCBI-GeneID: 7130
NCBI-ProteinID: NP_009046
OMIM: 600410
HGNC: 11898
Ensembl: ENSG00000123610
Vega: OTTHUMG00000131884
Pharos: P98066(Tbio)
UniProt: P98066
Structure
PDB: 
2PF5 2WNO 2N40 1O7B 1O7C

Position
2q23.3
AA seq 277 aa
MIILIYLFLLLWEDTQGWGFKDGIFHNSIWLERAAGVYHREARSGKYKLTYAEAKAVCEF
EGGHLATYKQLEAARKIGFHVCAAGWMAKGRVGYPIVKPGPNCGFGKTGIIDYGIRLNRS
ERWDAYCYNPHAKECGGVFTDPKQIFKSPGFPNEYEDNQICYWHIRLKYGQRIHLSFLDF
DLEDDPGCLADYVEIYDSYDDVHGFVGRYCGDELPDDIISTGNVMTLKFLSDASVTAGGF
QIKYVAMDPVSKSSQGKNTSTTSTGNKNFLAGRFSHL
NT seq 834 nt   +upstreamnt  +downstreamnt
atgatcatcttaatttacttatttctcttgctatgggaagacactcaaggatggggattc
aaggatggaatttttcataactccatatggcttgaacgagcagccggtgtgtaccacaga
gaagcacggtctggcaaatacaagctcacctacgcagaagctaaggcggtgtgtgaattt
gaaggcggccatctcgcaacttacaagcagctagaggcagccagaaaaattggatttcat
gtctgtgctgctggatggatggctaagggcagagttggataccccattgtgaagccaggg
cccaactgtggatttggaaaaactggcattattgattatggaatccgtctcaataggagt
gaaagatgggatgcctattgctacaacccacacgcaaaggagtgtggtggcgtctttaca
gatccaaagcaaatttttaaatctccaggcttcccaaatgagtacgaagataaccaaatc
tgctactggcacattagactcaagtatggtcagcgtattcacctgagttttttagatttt
gaccttgaagatgacccaggttgcttggctgattatgttgaaatatatgacagttacgat
gatgtccatggctttgtgggaagatactgtggagatgagcttccagatgacatcatcagt
acaggaaatgtcatgaccttgaagtttctaagtgatgcttcagtgacagctggaggtttc
caaatcaaatatgttgcaatggatcctgtatccaaatccagtcaaggaaaaaatacaagt
actacttctactggaaataaaaactttttagctggaagatttagccacttataa

DBGET integrated database retrieval system