KEGG   Homo sapiens (human): 7132Help
Entry
7132              CDS       T01001                                 

Gene name
TNFRSF1A, CD120a, FPF, TBP1, TNF-R, TNF-R-I, TNF-R55, TNFAR, TNFR1, TNFR55, TNFR60, p55, p55-R, p60
Definition
(RefSeq) TNF receptor superfamily member 1A
  KO
K03158  tumor necrosis factor receptor superfamily member 1A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04064  NF-kappa B signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04150  mTOR signaling pathway
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa04217  Necroptosis
hsa04380  Osteoclast differentiation
hsa04668  TNF signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05418  Fluid shear stress and atherosclerosis
Network
N00145  Extrinsic apoptotic pathway
N00151  TNF-NFKB signaling pathway
N00193  HPV E6 to host-cell-protein inhibition
N00350  HPV E6 to extrinsic apoptotic pathway
N00441  HIV gp120 to TNF-NFKB signaling pathway
N00444  TNF-p38 signaling pathway
N00446  TNF-JNK signaling pathway
Disease
H00912  Tumor necrosis factor receptor-associated periodic syndrome
H01490  Multiple sclerosis
Drug target
Tasonermin: D08562
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    7132 (TNFRSF1A)
   04064 NF-kappa B signaling pathway
    7132 (TNFRSF1A)
   04668 TNF signaling pathway
    7132 (TNFRSF1A)
   04071 Sphingolipid signaling pathway
    7132 (TNFRSF1A)
   04150 mTOR signaling pathway
    7132 (TNFRSF1A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7132 (TNFRSF1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    7132 (TNFRSF1A)
   04215 Apoptosis - multiple species
    7132 (TNFRSF1A)
   04217 Necroptosis
    7132 (TNFRSF1A)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    7132 (TNFRSF1A)
  09158 Development
   04380 Osteoclast differentiation
    7132 (TNFRSF1A)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    7132 (TNFRSF1A)
   05014 Amyotrophic lateral sclerosis (ALS)
    7132 (TNFRSF1A)
  09165 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    7132 (TNFRSF1A)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    7132 (TNFRSF1A)
   04931 Insulin resistance
    7132 (TNFRSF1A)
  09167 Infectious diseases
   05152 Tuberculosis
    7132 (TNFRSF1A)
   05166 HTLV-I infection
    7132 (TNFRSF1A)
   05164 Influenza A
    7132 (TNFRSF1A)
   05160 Hepatitis C
    7132 (TNFRSF1A)
   05168 Herpes simplex infection
    7132 (TNFRSF1A)
   05163 Human cytomegalovirus infection
    7132 (TNFRSF1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    7132 (TNFRSF1A)
   05165 Human papillomavirus infection
    7132 (TNFRSF1A)
   05145 Toxoplasmosis
    7132 (TNFRSF1A)
   05142 Chagas disease (American trypanosomiasis)
    7132 (TNFRSF1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    7132 (TNFRSF1A)
   04090 CD Molecules [BR:hsa04090]
    7132 (TNFRSF1A)
Cytokine receptors [BR:hsa04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   7132 (TNFRSF1A)
CD molecules [BR:hsa04090]
 Proteins
  7132 (TNFRSF1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6 Death
Motif
Other DBs
NCBI-GeneID: 7132
NCBI-ProteinID: NP_001056
OMIM: 191190
HGNC: 11916
Ensembl: ENSG00000067182
Vega: OTTHUMG00000168267
Pharos: P19438(Tchem)
UniProt: P19438
Structure
PDB: 

Position
12p13.31
AA seq 455 aa AA seqDB search
MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCT
KCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVD
RDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECV
SCSNCKKSLECTKLCLPQIENVKGTEDSGTTVLLPLVIFFGLCLLSLLFIGLMYRYQRWK
SKLYSIVCGKSTPEKEGELEGTTTKPLAPNPSFSPTPGFTPTLGFSPVPSSTFTSSSTYT
PGDCPNFAAPRREVAPPYQGADPILATALASDPIPNPLQKWEDSAHKPQSLDTDDPATLY
AVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQYSMLATWRRRTPRREATLEL
LGRVLRDMDLLGCLEDIEEALCGPAALPPAPSLLR
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgggcctctccaccgtgcctgacctgctgctgccactggtgctcctggagctgttggtg
ggaatatacccctcaggggttattggactggtccctcacctaggggacagggagaagaga
gatagtgtgtgtccccaaggaaaatatatccaccctcaaaataattcgatttgctgtacc
aagtgccacaaaggaacctacttgtacaatgactgtccaggcccggggcaggatacggac
tgcagggagtgtgagagcggctccttcaccgcttcagaaaaccacctcagacactgcctc
agctgctccaaatgccgaaaggaaatgggtcaggtggagatctcttcttgcacagtggac
cgggacaccgtgtgtggctgcaggaagaaccagtaccggcattattggagtgaaaacctt
ttccagtgcttcaattgcagcctctgcctcaatgggaccgtgcacctctcctgccaggag
aaacagaacaccgtgtgcacctgccatgcaggtttctttctaagagaaaacgagtgtgtc
tcctgtagtaactgtaagaaaagcctggagtgcacgaagttgtgcctaccccagattgag
aatgttaagggcactgaggactcaggcaccacagtgctgttgcccctggtcattttcttt
ggtctttgccttttatccctcctcttcattggtttaatgtatcgctaccaacggtggaag
tccaagctctactccattgtttgtgggaaatcgacacctgaaaaagagggggagcttgaa
ggaactactactaagcccctggccccaaacccaagcttcagtcccactccaggcttcacc
cccaccctgggcttcagtcccgtgcccagttccaccttcacctccagctccacctatacc
cccggtgactgtcccaactttgcggctccccgcagagaggtggcaccaccctatcagggg
gctgaccccatccttgcgacagccctcgcctccgaccccatccccaacccccttcagaag
tgggaggacagcgcccacaagccacagagcctagacactgatgaccccgcgacgctgtac
gccgtggtggagaacgtgcccccgttgcgctggaaggaattcgtgcggcgcctagggctg
agcgaccacgagatcgatcggctggagctgcagaacgggcgctgcctgcgcgaggcgcaa
tacagcatgctggcgacctggaggcggcgcacgccgcggcgcgaggccacgctggagctg
ctgggacgcgtgctccgcgacatggacctgctgggctgcctggaggacatcgaggaggcg
ctttgcggccccgccgccctcccgcccgcgcccagtcttctcagatga

KEGG   Homo sapiens (human): 7133Help
Entry
7133              CDS       T01001                                 

Gene name
TNFRSF1B, CD120b, TBPII, TNF-R-II, TNF-R75, TNFBR, TNFR1B, TNFR2, TNFR80, p75, p75TNFR
Definition
(RefSeq) TNF receptor superfamily member 1B
  KO
K05141  tumor necrosis factor receptor superfamily member 1B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04668  TNF signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05170  Human immunodeficiency virus 1 infection
Network
N00374  TNF-IRF1 signaling pathway
Disease
H00084  Graft-versus-host disease
Drug target
Tasonermin: D08562
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    7133 (TNFRSF1B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7133 (TNFRSF1B)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    7133 (TNFRSF1B)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    7133 (TNFRSF1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    7133 (TNFRSF1B)
   04090 CD Molecules [BR:hsa04090]
    7133 (TNFRSF1B)
Cytokine receptors [BR:hsa04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   7133 (TNFRSF1B)
CD molecules [BR:hsa04090]
 Proteins
  7133 (TNFRSF1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6
Motif
Other DBs
NCBI-GeneID: 7133
NCBI-ProteinID: NP_001057
OMIM: 191191
HGNC: 11917
Ensembl: ENSG00000028137
Vega: OTTHUMG00000001829
Pharos: P20333(Tbio)
UniProt: P20333
Structure
PDB: 

Position
1p36.22
AA seq 461 aa AA seqDB search
MAPVAVWAALAVGLELWAAAHALPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPG
QHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTC
RPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICR
PHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTS
FLLPMGPSPPAEGSTGDFALPVGLIVGVTALGLLIIGVVNCVIMTQVKKKPLCLQREAKV
PHLPADKARGTQGPEQQHLLITAPSSSSSSLESSASALDRRAPTRNQPQAPGVEASGAGE
ARASTGSSDSSPGGHGTQVNVTCIVNVCSSSDHSSQCSSQASSTMGDTDSSPSESPKDEQ
VPFSKEECAFRSQLETPETLLGSTEEKPLPLGVPDAGMKPS
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccgtcgccgtctgggccgcgctggccgtcggactggagctctgggctgcggcg
cacgccttgcccgcccaggtggcatttacaccctacgccccggagcccgggagcacatgc
cggctcagagaatactatgaccagacagctcagatgtgctgcagcaaatgctcgccgggc
caacatgcaaaagtcttctgtaccaagacctcggacaccgtgtgtgactcctgtgaggac
agcacatacacccagctctggaactgggttcccgagtgcttgagctgtggctcccgctgt
agctctgaccaggtggaaactcaagcctgcactcgggaacagaaccgcatctgcacctgc
aggcccggctggtactgcgcgctgagcaagcaggaggggtgccggctgtgcgcgccgctg
cgcaagtgccgcccgggcttcggcgtggccagaccaggaactgaaacatcagacgtggtg
tgcaagccctgtgccccggggacgttctccaacacgacttcatccacggatatttgcagg
ccccaccagatctgtaacgtggtggccatccctgggaatgcaagcatggatgcagtctgc
acgtccacgtcccccacccggagtatggccccaggggcagtacacttaccccagccagtg
tccacacgatcccaacacacgcagccaactccagaacccagcactgctccaagcacctcc
ttcctgctcccaatgggccccagccccccagctgaagggagcactggcgacttcgctctt
ccagttggactgattgtgggtgtgacagccttgggtctactaataataggagtggtgaac
tgtgtcatcatgacccaggtgaaaaagaagcccttgtgcctgcagagagaagccaaggtg
cctcacttgcctgccgataaggcccggggtacacagggccccgagcagcagcacctgctg
atcacagcgccgagctccagcagcagctccctggagagctcggccagtgcgttggacaga
agggcgcccactcggaaccagccacaggcaccaggcgtggaggccagtggggccggggag
gcccgggccagcaccgggagctcagattcttcccctggtggccatgggacccaggtcaat
gtcacctgcatcgtgaacgtctgtagcagctctgaccacagctcacagtgctcctcccaa
gccagctccacaatgggagacacagattccagcccctcggagtccccgaaggacgagcag
gtccccttctccaaggaggaatgtgcctttcggtcacagctggagacgccagagaccctg
ctggggagcaccgaagagaagcccctgccccttggagtgcctgatgctgggatgaagccc
agttaa

DBGET integrated database retrieval system