KEGG   Homo sapiens (human): 7133Help
Entry
7133              CDS       T01001                                 

Gene name
TNFRSF1B, CD120b, TBPII, TNF-R-II, TNF-R75, TNFBR, TNFR1B, TNFR2, TNFR80, p75, p75TNFR
Definition
(RefSeq) TNF receptor superfamily member 1B
  KO
K05141  tumor necrosis factor receptor superfamily member 1B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04668  TNF signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05170  Human immunodeficiency virus 1 infection
Network
N00374  TNF-IRF1 signaling pathway
Disease
H00084  Graft-versus-host disease
Drug target
Tasonermin: D08562
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    7133 (TNFRSF1B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7133 (TNFRSF1B)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    7133 (TNFRSF1B)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    7133 (TNFRSF1B)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    7133 (TNFRSF1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    7133 (TNFRSF1B)
   04090 CD molecules [BR:hsa04090]
    7133 (TNFRSF1B)
Cytokine receptors [BR:hsa04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   7133 (TNFRSF1B)
CD molecules [BR:hsa04090]
 Proteins
  7133 (TNFRSF1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6
Motif
Other DBs
NCBI-GeneID: 7133
NCBI-ProteinID: NP_001057
OMIM: 191191
HGNC: 11917
Ensembl: ENSG00000028137
Vega: OTTHUMG00000001829
Pharos: P20333(Tbio)
UniProt: P20333
Structure
PDB: 

Position
1p36.22
AA seq 461 aa AA seqDB search
MAPVAVWAALAVGLELWAAAHALPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPG
QHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTC
RPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICR
PHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTS
FLLPMGPSPPAEGSTGDFALPVGLIVGVTALGLLIIGVVNCVIMTQVKKKPLCLQREAKV
PHLPADKARGTQGPEQQHLLITAPSSSSSSLESSASALDRRAPTRNQPQAPGVEASGAGE
ARASTGSSDSSPGGHGTQVNVTCIVNVCSSSDHSSQCSSQASSTMGDTDSSPSESPKDEQ
VPFSKEECAFRSQLETPETLLGSTEEKPLPLGVPDAGMKPS
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccgtcgccgtctgggccgcgctggccgtcggactggagctctgggctgcggcg
cacgccttgcccgcccaggtggcatttacaccctacgccccggagcccgggagcacatgc
cggctcagagaatactatgaccagacagctcagatgtgctgcagcaaatgctcgccgggc
caacatgcaaaagtcttctgtaccaagacctcggacaccgtgtgtgactcctgtgaggac
agcacatacacccagctctggaactgggttcccgagtgcttgagctgtggctcccgctgt
agctctgaccaggtggaaactcaagcctgcactcgggaacagaaccgcatctgcacctgc
aggcccggctggtactgcgcgctgagcaagcaggaggggtgccggctgtgcgcgccgctg
cgcaagtgccgcccgggcttcggcgtggccagaccaggaactgaaacatcagacgtggtg
tgcaagccctgtgccccggggacgttctccaacacgacttcatccacggatatttgcagg
ccccaccagatctgtaacgtggtggccatccctgggaatgcaagcatggatgcagtctgc
acgtccacgtcccccacccggagtatggccccaggggcagtacacttaccccagccagtg
tccacacgatcccaacacacgcagccaactccagaacccagcactgctccaagcacctcc
ttcctgctcccaatgggccccagccccccagctgaagggagcactggcgacttcgctctt
ccagttggactgattgtgggtgtgacagccttgggtctactaataataggagtggtgaac
tgtgtcatcatgacccaggtgaaaaagaagcccttgtgcctgcagagagaagccaaggtg
cctcacttgcctgccgataaggcccggggtacacagggccccgagcagcagcacctgctg
atcacagcgccgagctccagcagcagctccctggagagctcggccagtgcgttggacaga
agggcgcccactcggaaccagccacaggcaccaggcgtggaggccagtggggccggggag
gcccgggccagcaccgggagctcagattcttcccctggtggccatgggacccaggtcaat
gtcacctgcatcgtgaacgtctgtagcagctctgaccacagctcacagtgctcctcccaa
gccagctccacaatgggagacacagattccagcccctcggagtccccgaaggacgagcag
gtccccttctccaaggaggaatgtgcctttcggtcacagctggagacgccagagaccctg
ctggggagcaccgaagagaagcccctgccccttggagtgcctgatgctgggatgaagccc
agttaa

DBGET integrated database retrieval system