KEGG   Homo sapiens (human): 7134Help
Entry
7134              CDS       T01001                                 

Gene name
TNNC1, CMD1Z, CMH13, TN-C, TNC, TNNC
Definition
(RefSeq) troponin C1, slow skeletal and cardiac type
  KO
K05865  troponin C, slow skeletal and cardiac muscles
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04260  Cardiac muscle contraction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05414  Dilated cardiomyopathy (DCM)
Disease
H00292  Hypertrophic cardiomyopathy (HCM)
H00294  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    7134 (TNNC1)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    7134 (TNNC1)
   04261 Adrenergic signaling in cardiomyocytes
    7134 (TNNC1)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    7134 (TNNC1)
   05414 Dilated cardiomyopathy (DCM)
    7134 (TNNC1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Troponins
     7134 (TNNC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_8 EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_9 EF-hand_4 SPARC_Ca_bdg EF-hand_10 Dak2 EMG1
Motif
Other DBs
NCBI-GeneID: 7134
NCBI-ProteinID: NP_003271
OMIM: 191040
HGNC: 11943
Ensembl: ENSG00000114854
Vega: OTTHUMG00000158572
Pharos: P63316(Tclin)
UniProt: P63316 Q6FH91
Structure
PDB: 

Position
3p21.1
AA seq 161 aa AA seqDB search
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEM
IDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIM
LQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggatgacatctacaaggctgcggtagagcagctgacagaagagcagaaaaatgagttc
aaggcagccttcgacatcttcgtgctgggcgctgaggatggctgcatcagcaccaaggag
ctgggcaaggtgatgaggatgctgggccagaaccccacccctgaggagctgcaggagatg
atcgatgaggtggacgaggacggcagcggcacggtggactttgatgagttcctggtcatg
atggttcggtgcatgaaggacgacagcaaagggaaatctgaggaggagctgtctgacctc
ttccgcatgtttgacaaaaatgctgatggctacatcgacctggatgagctgaagataatg
ctgcaggctacaggcgagaccatcacggaggacgacatcgaggagctcatgaaggacgga
gacaagaacaacgacggccgcatcgactatgatgagttcctggagttcatgaagggtgtg
gagtag

DBGET integrated database retrieval system