KEGG   Homo sapiens (human): 7135Help
Entry
7135              CDS       T01001                                 

Gene name
TNNI1, SSTNI, TNN1
Definition
(RefSeq) troponin I1, slow skeletal type
  KO
K10371  troponin I, slow skeletal muscle
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    7135 (TNNI1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Troponins
     7135 (TNNI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Troponin
Motif
Other DBs
NCBI-GeneID: 7135
NCBI-ProteinID: NP_003272
OMIM: 191042
HGNC: 11945
Ensembl: ENSG00000159173
Vega: OTTHUMG00000035736
Pharos: P19237(Tbio)
UniProt: P19237
Position
1q32.1
AA seq 187 aa AA seqDB search
MPEVERKPKITASRKLLLKSLMLAKAKECWEQEHEEREAEKVRYLAERIPTLQTRGLSLS
ALQDLCRELHAKVEVVDEERYDIEAKCLHNTREIKDLKLKVMDLRGKFKRPPLRRVRVSA
DAMLRALLGSKHKVSMDLRANLKSVKKEDTEKERPVEVGDWRKNVEAMSGMEGRKKMFDA
AKSPTSQ
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgccggaagtcgagagaaaacccaagatcactgcctcccgcaaactcttgctgaagagc
ctgatgctggccaaggccaaggaatgctgggagcaggagcacgaggagcgcgaggctgag
aaggtgcgctacctggcagagcgcatccccacgctgcagacccgtggcctgtccctcagt
gccctgcaggacctgtgccgggagctgcacgccaaggtggaggtggtggatgaggagcga
tacgacattgaggccaaatgcctccacaacaccagggagattaaggacctgaagctgaag
gtgatggacctccgtgggaagttcaagcgcccgcccctgcgtcgagtccgtgtctcggct
gacgccatgctccgggccctgctgggctccaagcacaaggtgtccatggatctgcgggcc
aacctcaagtctgtgaagaaggaagacacagagaaggagcggcctgtggaggtgggtgac
tggaggaagaacgtggaggccatgtctggcatggaaggccggaagaagatgtttgatgcc
gccaagtctccgacctcacaatag

DBGET integrated database retrieval system