KEGG   Homo sapiens (human): 7136Help
Entry
7136              CDS       T01001                                 

Gene name
TNNI2, AMCD2B, DA2B, FSSV, fsTnI
Definition
(RefSeq) troponin I2, fast skeletal type
  KO
K12043  troponin I, fast skeletal muscle
Organism
hsa  Homo sapiens (human)
Disease
H00811  Distal arthrogryposis
Drug target
Reldesemtiv: D11363
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    7136 (TNNI2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Troponins
     7136 (TNNI2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Troponin DUF2408 Tup_N DUF919 Laminin_II SKA2 Prominin
Motif
Other DBs
NCBI-GeneID: 7136
NCBI-ProteinID: NP_001139301
OMIM: 191043
HGNC: 11946
Ensembl: ENSG00000130598
Vega: OTTHUMG00000012253
Pharos: P48788(Tbio)
UniProt: P48788
Position
11p15.5
AA seq 182 aa AA seqDB search
MGDEEKRNRAITARRQHLKSVMLQIAATELEKEESRREAEKQNYLAEHCPPLHIPGSMSE
VQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKLFDLRGKFKRPPLRRVRMSAD
AMLKALLGSKHKVCMDLRANLKQVKKEDTEKERDLRDVGDWRKNIEEKSGMEGRKKMFES
ES
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgggagatgaggagaagcggaacagggccatcacggcccgcaggcagcacctgaagagt
gtgatgctgcagatagcggccacggagctggagaaggaggagagccgccgtgaggcagag
aagcagaactacctggcggagcactgcccgccgctgcatatcccgggctccatgtctgaa
gtgcaggagctctgcaaacagctgcacgccaagatcgatgcggctgaagaggagaagtac
gacatggaggtgagggtgcagaagaccagcaaggagctggaggacatgaaccagaagcta
tttgatctgcggggcaagttcaagcggcccccactgcggagggtgcgcatgtcggccgat
gccatgctcaaggccctgctgggctcgaagcacaaggtgtgcatggacctgagggccaac
ctgaagcaggtcaagaaggaggacacagagaaggagcgggacctgcgagacgtgggtgac
tggaggaagaacatcgaggagaagtctggcatggagggccggaagaagatgtttgagtcc
gagtcctag

DBGET integrated database retrieval system