KEGG   Homo sapiens (human): 7136
Entry
7136              CDS       T01001                                 
Symbol
TNNI2, AMCD2B, DA2B, DA2B1, FSSV, fsTnI
Name
(RefSeq) troponin I2, fast skeletal type
  KO
K12043  troponin I, fast skeletal muscle
Organism
hsa  Homo sapiens (human)
Pathway
hsa04814  Motor proteins
hsa04820  Cytoskeleton in muscle cells
Network
nt06539  Cytoskeleton in muscle cells
  Element
N01818  Actin thin filament, muscle contraction
Disease
H00811  Distal arthrogryposis
Drug target
Reldesemtiv: D11363
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04814 Motor proteins
    7136 (TNNI2)
   04820 Cytoskeleton in muscle cells
    7136 (TNNI2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    7136 (TNNI2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Troponins
     7136 (TNNI2)
SSDB
Motif
Pfam: Troponin Tup_N DUF919 DUF2408 Laminin_II Prominin SKA2
Other DBs
NCBI-GeneID: 7136
NCBI-ProteinID: NP_001139301
OMIM: 191043
HGNC: 11946
Ensembl: ENSG00000130598
UniProt: P48788
Position
11:1838981..1841678
AA seq 182 aa
MGDEEKRNRAITARRQHLKSVMLQIAATELEKEESRREAEKQNYLAEHCPPLHIPGSMSE
VQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKLFDLRGKFKRPPLRRVRMSAD
AMLKALLGSKHKVCMDLRANLKQVKKEDTEKERDLRDVGDWRKNIEEKSGMEGRKKMFES
ES
NT seq 549 nt   +upstreamnt  +downstreamnt
atgggagatgaggagaagcggaacagggccatcacggcccgcaggcagcacctgaagagt
gtgatgctgcagatagcggccacggagctggagaaggaggagagccgccgtgaggcagag
aagcagaactacctggcggagcactgcccgccgctgcatatcccgggctccatgtctgaa
gtgcaggagctctgcaaacagctgcacgccaagatcgatgcggctgaagaggagaagtac
gacatggaggtgagggtgcagaagaccagcaaggagctggaggacatgaaccagaagcta
tttgatctgcggggcaagttcaagcggcccccactgcggagggtgcgcatgtcggccgat
gccatgctcaaggccctgctgggctcgaagcacaaggtgtgcatggacctgagggccaac
ctgaagcaggtcaagaaggaggacacagagaaggagcgggacctgcgagacgtgggtgac
tggaggaagaacatcgaggagaagtctggcatggagggccggaagaagatgtttgagtcc
gagtcctag

DBGET integrated database retrieval system