KEGG   Homo sapiens (human): 7156
Entry
7156              CDS       T01001                                 

Gene name
TOP3A, MGRISCE2, PEOB5, TOP3, ZGRF7
Definition
(RefSeq) DNA topoisomerase III alpha
  KO
K03165  DNA topoisomerase III [EC:5.6.2.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03440  Homologous recombination
hsa03460  Fanconi anemia pathway
Disease
H02492  Microcephaly, growth restriction, and increased sister chromatid exchange
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    7156 (TOP3A)
   03460 Fanconi anemia pathway
    7156 (TOP3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    7156 (TOP3A)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    7156 (TOP3A)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.1  DNA topoisomerase
     7156 (TOP3A)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Topoisomerases
   7156 (TOP3A)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Bloom's syndrome complex (BTR)
     7156 (TOP3A)
   FA (Fanconi anemia) pathway
     7156 (TOP3A)
SSDB
Motif
Pfam: Topoisom_bac zf-GRF Toprim zf-C4_Topoisom zf-C2H2_10
Other DBs
NCBI-GeneID: 7156
NCBI-ProteinID: NP_004609
OMIM: 601243
HGNC: 11992
Ensembl: ENSG00000177302
Vega: OTTHUMG00000059391
Pharos: Q13472(Tbio)
UniProt: Q13472
Structure
PDB: 
4CGY 4CHT

Position
17p11.2
AA seq 1001 aa
MIFPVARYALRWLRRPEDRAFSRAAMEMALRGVRKVLCVAEKNDAAKGIADLLSNGRMRR
REGLSKFNKIYEFDYHLYGQNVTMVMTSVSGHLLAHDFQMQFRKWQSCNPLVLFEAEIEK
YCPENFVDIKKTLERETRQCQALVIWTDCDREGENIGFEIIHVCKAVKPNLQVLRARFSE
ITPHAVRTACENLTEPDQRVSDAVDVRQELDLRIGAAFTRFQTLRLQRIFPEVLAEQLIS
YGSCQFPTLGFVVERFKAIQAFVPEIFHRIKVTHDHKDGIVEFNWKRHRLFNHTACLVLY
QLCVEDPMATVVEVRSKPKSKWRPQALDTVELEKLASRKLRINAKETMRIAEKLYTQGYI
SYPRTETNIFPRDLNLTVLVEQQTPDPRWGAFAQSILERGGPTPRNGNKSDQAHPPIHPT
KYTNNLQGDEQRLYEFIVRHFLACCSQDAQGQETTVEIDIAQERFVAHGLMILARNYLDV
YPYDHWSDKILPVYEQGSHFQPSTVEMVDGETSPPKLLTEADLIALMEKHGIGTDATHAE
HIETIKARMYVGLTPDKRFLPGHLGMGLVEGYDSMGYEMSKPDLRAELEADLKLICDGKK
DKFVVLRQQVQKYKQVFIEAVAKAKKLDEALAQYFGNGTELAQQEDIYPAMPEPIRKCPQ
CNKDMVLKTKKNGGFYLSCMGFPECRSAVWLPDSVLEASRDSSVCPVCQPHPVYRLKLKF
KRGSLPPTMPLEFVCCIGGCDDTLREILDLRFSGGPPRASQPSGRLQANQSLNRMDNSQH
PQPADSRQTGSSKALAQTLPPPTAAGESNSVTCNCGQEAVLLTVRKEGPNRGRQFFKCNG
GSCNFFLWADSPNPGAGGPPALAYRPLGASLGCPPGPGIHLGGFGNPGDGSGSGTSCLCS
QPSVTRTVQKDGPNKGRQFHTCAKPREQQCGFFQWVDENTAPGTSGAPSWTGDRGRTLES
EARSKRPRASSSDMGSTAKKPRKCSLCHQPGHTRPFCPQNR
NT seq 3006 nt   +upstreamnt  +downstreamnt
atgatctttcctgtcgcccgctacgcgctccggtggctgcgacggcccgaagaccgtgcc
ttttcccgcgccgccatggagatggccctccgaggcgtgcggaaagtcctctgtgtggcc
gaaaaaaacgacgcggccaaggggatcgccgacctgctgtcaaacggtcgcatgaggcgg
agagaaggactttcaaaattcaacaagatctatgaatttgattatcatctgtatggccag
aatgttaccatggtaatgacttcagtttctggacatttactggctcatgatttccagatg
cagtttcgaaaatggcagagctgcaaccctcttgtcctctttgaagcagaaattgaaaag
tactgcccagagaattttgtagacatcaagaaaactttggaacgagagactcgccagtgc
caggctctggtgatctggactgactgtgatagagaaggcgaaaacatcgggtttgagatt
atccacgtgtgtaaggctgtaaagcccaatctgcaggtgttgcgagcccgattctctgag
atcacaccccatgccgtcaggacagcttgtgaaaacctgaccgagcctgatcagagggtg
agcgatgctgtggatgtgaggcaggagctggacctgaggattggagctgcctttactagg
ttccagaccctgcggcttcagaggatttttcctgaggtgctggcagagcagctcatcagt
tacggcagctgccagttccccacactgggctttgtggtggagcggttcaaagccattcag
gcttttgtaccagaaatcttccacagaattaaagtaactcatgaccacaaagatggtatc
gtagaattcaactggaaaaggcatcgactctttaaccacacggcttgcctagttctctat
cagttgtgtgtggaggatcccatggcaactgtggtagaggtcagatctaagcccaagagc
aagtggcggcctcaagccttggacactgtggagcttgagaagctggcttctcgaaagttg
agaataaatgctaaagaaaccatgaggattgctgagaagctctacactcaagggtacatc
agctatccccgaacagaaacaaacatttttcccagagacttaaacctgacggtgttggtg
gaacagcagacccccgatccacgctggggggcctttgcccagagcattctagagcggggt
ggtcccaccccacgcaatgggaacaagtctgaccaagctcaccctcccattcaccccacc
aaatacaccaacaacttacagggagatgaacagcgactgtacgagtttattgttcgccat
ttcctggcttgctgctcccaggatgctcaggggcaggagaccacagtggagatcgacatc
gctcaggaacgctttgtggcccatggcctcatgattctggcccgaaactatctggatgtg
tatccatatgatcactggagtgacaagatcctccctgtctatgagcaaggatcccacttt
cagcccagcaccgtggagatggtggacggggagaccagcccacccaagctgctcaccgag
gccgacctcattgccctcatggagaagcatggcattggtacggatgccactcatgcggag
cacatcgagaccatcaaagcccggatgtacgtgggcctcaccccagacaagcggttcctc
cctgggcacctgggcatgggacttgtggaaggttatgattccatgggctatgaaatgtct
aagcctgacctccgggctgaactggaagctgatctgaagctgatctgtgatggcaaaaag
gacaaatttgtggttctaaggcagcaagtgcagaaatacaagcaggttttcattgaagcg
gtggctaaagcaaagaaattggacgaggccttggcccagtactttgggaatgggacagag
ttggcccagcaagaagatatctacccagccatgccagagcccatcaggaagtgcccacag
tgcaacaaggacatggtccttaagaccaagaagaatggcgggttctacctcagctgcatg
ggtttcccagagtgtcgctcagctgtgtggcttcctgactcggtgctggaggccagcagg
gacagcagtgtgtgtccagtttgtcagccacaccctgtgtacaggttaaagttaaagttt
aagcgcggtagccttcccccgaccatgcctctggagtttgtttgctgcatcggcggatgc
gacgacaccctgagggagatcctggacctgagattttcagggggcccccccagggctagc
cagccctctggccgcctgcaggctaaccagtccctgaacaggatggacaacagccagcac
ccccagcctgctgacagcagacagactgggtcctcaaaggctctggcccagaccctccca
ccacccacggctgctggtgaaagcaattctgtgacctgcaactgtggccaggaggctgtg
ctgctcactgtccgtaaggagggccccaaccggggccggcagttctttaagtgcaacgga
ggtagctgcaacttcttcctgtgggcagacagccccaatccgggagcaggagggcctcct
gccttggcatatagacccctgggcgcctccctgggatgcccaccaggcccagggatccac
ctaggtgggtttggcaaccctggtgatggcagtggtagtggcacatcctgcctttgcagc
cagccctccgtcacacggactgtgcagaaggatggacccaacaaggggcgccagttccac
acatgtgccaagccgagagagcagcagtgtggctttttccagtgggtcgatgagaacacc
gctccagggacttctggagccccgtcctggacaggagacagaggaagaaccctggagtcg
gaagccagaagcaaaaggccccgggccagttcctcagacatggggtccacagcaaagaaa
ccccggaaatgcagcctttgccaccagcctggacacacccgtcccttttgtcctcagaac
agatga

DBGET integrated database retrieval system