KEGG   Homo sapiens (human): 7158Help
Entry
7158              CDS       T01001                                 

Gene name
TP53BP1, 53BP1, TDRD30, p202, p53BP1
Definition
(RefSeq) tumor protein p53 binding protein 1
  KO
K20915  tumor suppressor p53-binding protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    7158 (TP53BP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 53-BP1_Tudor BRCT_3 TUDOR_5 BRCT BRCT_2 RTT107_BRCT_5 DUF4537 Tudor_2
Motif
Other DBs
NCBI-GeneID: 7158
NCBI-ProteinID: NP_005648
OMIM: 605230
HGNC: 11999
Ensembl: ENSG00000067369
Vega: OTTHUMG00000059757
Pharos: Q12888(Tbio)
UniProt: Q12888
Structure
PDB: 

Position
15q15.3
AA seq 1972 aa AA seqDB search
MDPTGSQLDSDFSQQDTPCLIIEDSQPESQVLEDDSGSHFSMLSRHLPNLQTHKENPVLD
VVSNPEQTAGEERGDGNSGFNEHLKENKVADPVDSSNLDTCGSISQVIEQLPQPNRTSSV
LGMSVESAPAVEEEKGEELEQKEKEKEEDTSGNTTHSLGAEDTASSQLGFGVLELSQSQD
VEENTVPYEVDKEQLQSVTTNSGYTRLSDVDANTAIKHEEQSNEDIPIAEQSSKDIPVTA
QPSKDVHVVKEQNPPPARSEDMPFSPKASVAAMEAKEQLSAQELMESGLQIQKSPEPEVL
STQEDLFDQSNKTVSSDGCSTPSREEGGCSLASTPATTLHLLQLSGQRSLVQDSLSTNSS
DLVAPSPDAFRSTPFIVPSSPTEQEGRQDKPMDTSVLSEEGGEPFQKKLQSGEPVELENP
PLLPESTVSPQASTPISQSTPVFPPGSLPIPSQPQFSHDIFIPSPSLEEQSNDGKKDGDM
HSSSLTVECSKTSEIEPKNSPEDLGLSLTGDSCKLMLSTSEYSQSPKMESLSSHRIDEDG
ENTQIEDTEPMSPVLNSKFVPAENDSILMNPAQDGEVQLSQNDDKTKGDDTDTRDDISIL
ATGCKGREETVAEDVCIDLTCDSGSQAVPSPATRSEALSSVLDQEEAMEIKEHHPEEGSS
GSEVEEIPETPCESQGEELKEENMESVPLHLSLTETQSQGLCLQKEMPKKECSEAMEVET
SVISIDSPQKLAILDQELEHKEQEAWEEATSEDSSVVIVDVKEPSPRVDVSCEPLEGVEK
CSDSQSWEDIAPEIEPCAENRLDTKEEKSVEYEGDLKSGTAETEPVEQDSSQPSLPLVRA
DDPLRLDQELQQPQTQEKTSNSLTEDSKMANAKQLSSDAEAQKLGKPSAHASQSFCESSS
ETPFHFTLPKEGDIIPPLTGATPPLIGHLKLEPKRHSTPIGISNYPESTIATSDVMSESM
VETHDPILGSGKGDSGAAPDVDDKLCLRMKLVSPETEASEESLQFNLEKPATGERKNGST
AVAESVASPQKTMSVLSCICEARQENEARSEDPPTTPIRGNLLHFPSSQGEEEKEKLEGD
HTIRQSQQPMKPISPVKDPVSPASQKMVIQGPSSPQGEAMVTDVLEDQKEGRSTNKENPS
KALIERPSQNNIGIQTMECSLRVPETVSAATQTIKNVCEQGTSTVDQNFGKQDATVQTER
GSGEKPVSAPGDDTESLHSQGEEEFDMPQPPHGHVLHRHMRTIREVRTLVTRVITDVYYV
DGTEVERKVTEETEEPIVECQECETEVSPSQTGGSSGDLGDISSFSSKASSLHRTSSGTS
LSAMHSSGSSGKGAGPLRGKTSGTEPADFALPSSRGGPGKLSPRKGVSQTGTPVCEEDGD
AGLGIRQGGKAPVTPRGRGRRGRPPSRTTGTRETAVPGPLGIEDISPNLSPDDKSFSRVV
PRVPDSTRRTDVGAGALRRSDSPEIPFQAAAGPSDGLDASSPGNSFVGLRVVAKWSSNGY
FYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKG
HRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLGPYEAVTPLTKAADISLD
NLVEGKRKRRSNVSSPATPTASSSSSTTPTRKITESPRASMGVLSGKRKLITSEEERSPA
KRGRKSATVKPGAVGAGEFVSPCESGDNTGEPSALEEQRGPLPLNKTLFLGYAFLLTMAT
TSDKLASRSKLPDGPTGSSEEEEEFLEIPPFNKQYTESQLRAGAGYILEDFNEAQCNTAY
QCLLIADQHCRTRKYFLCLASGIPCVSHVWVHDSCHANQLQNYRNYLLPAGYSLEEQRIL
DWQPRENPFQNLKVLLVSDQQQNFLELWSEILMTGGAASVKQHHSSAHNKDIALGVFDVV
VTDPSCPASVLKCAEALQLPVVSQEWVIQCLIVGERIGFKQHPKYKHDYVSH
NT seq 5919 nt NT seq  +upstreamnt  +downstreamnt
atggaccctactggaagtcagttggattcagatttctctcagcaagatactccttgcctg
ataattgaagattctcagcctgaaagccaggttctagaggatgattctggttctcacttc
agtatgctatctcgacaccttcctaatctccagacgcacaaagaaaatcctgtgttggat
gttgtgtccaatcctgaacaaacagctggagaagaacgaggagacggtaatagtgggttc
aatgaacatttgaaagaaaacaaggttgcagaccctgtggattcttctaacttggacaca
tgtggttccatcagtcaggtcattgagcagttacctcagccaaacaggacaagcagtgtt
ctgggaatgtcagtggaatctgctcctgctgtggaggaagagaagggagaagagttggaa
cagaaggagaaagagaaggaagaagatacttcaggcaatactacacattcccttggtgct
gaagatactgcctcatcacagttgggttttggggttctggaactctcccagagccaggat
gttgaggaaaatactgtgccatatgaagtggacaaagagcagctacaatcagtaaccacc
aactctggttataccaggctgtctgatgtggatgctaatactgcaattaagcatgaagaa
cagtccaacgaagatatccccatagcagaacagtccagcaaggacatccctgtgacagca
cagcccagtaaggatgtacatgttgtaaaagagcaaaatccaccacctgcaaggtcagag
gacatgccttttagccccaaagcatctgttgctgctatggaagcaaaagaacagttgtct
gcacaagaacttatggaaagtggactgcagattcagaagtcaccagagcctgaggttttg
tcaactcaggaagacttgtttgaccagagcaataaaacagtatcttctgatggttgctct
actccttcaagggaggaaggtgggtgttctttggcttccactcctgccaccactctgcat
ctcctgcagctctctggtcagaggtcccttgttcaggacagtctttccacgaattcttca
gatcttgttgctccttctcctgatgctttccgatctactccttttatcgttcctagcagt
cccacagagcaagaagggagacaagataagccaatggacacgtcagtgttatctgaagaa
ggaggagagccttttcagaagaaacttcaaagtggtgaaccagtggagttagaaaacccc
cctctcctgcctgagtccactgtatcaccacaagcctcaacaccaatatctcagagcaca
ccagtcttccctcctgggtcacttcctatcccatcccagcctcagttttctcatgacatt
tttattccttccccaagtctggaagaacaatcaaatgatgggaagaaagatggagatatg
catagttcatctttgacagttgagtgttctaaaacttcagagattgaaccaaagaattcc
cctgaggatcttgggctatctttgacaggggattcttgcaagttgatgctttctacaagt
gaatatagtcagtccccaaagatggagagcttgagttctcacagaattgatgaagatgga
gaaaacacacagattgaggatacggaacccatgtctccagttctcaattctaaatttgtt
cctgctgaaaatgatagtatcctgatgaatccagcacaggatggtgaagtacaactgagt
cagaatgatgacaaaacaaagggagatgatacagacaccagggatgacattagtatttta
gccactggttgcaagggcagagaagaaacggtagcagaagatgtttgtattgatctcact
tgtgattcggggagtcaggcagttccgtcaccagctactcgatctgaggcactttctagt
gtgttagatcaggaggaagctatggaaattaaagaacaccatccagaggaggggtcttca
gggtctgaggtggaagaaatccctgagacaccttgtgaaagtcaaggagaggaactcaaa
gaagaaaatatggagagtgttccgttgcacctttctctgactgaaactcagtcccaaggg
ttgtgtcttcaaaaggaaatgccaaaaaaagaatgctcagaagctatggaagttgaaacc
agtgtgattagtattgattcccctcaaaagttggcaatacttgaccaagaattggaacat
aaggaacaggaagcttgggaagaagctacttcagaggactccagtgttgtcattgtagat
gtgaaagagccatctcccagagttgatgtttcttgtgaacctttggagggagtggagaag
tgctcagattcccagtcatgggaggatattgctccagaaatagaaccatgtgctgagaat
agattagacaccaaggaagaaaagagtgtagaatatgaaggagatctgaaatcagggact
gcagaaacagaacctgtagagcaagattcttcacagccttccttacctttagtgagagca
gatgatcctttaagacttgaccaggagttgcagcagccccaaactcaggagaaaacaagt
aattcattaacagaagactcaaaaatggctaatgcaaagcagctaagctcagatgcagag
gcccagaagctggggaagccctctgcccatgcctcacaaagcttctgtgaaagttctagt
gaaaccccatttcatttcactttgcctaaagaaggtgatatcatcccaccattgactggt
gcaaccccacctcttattgggcacctaaaattggagcccaagagacacagtactcctatt
ggtattagcaactatccagaaagcaccatagcaaccagtgatgtcatgtctgaaagcatg
gtggagacccatgatcccatacttgggagtggaaaaggggattctggggctgccccagac
gtggatgataaattatgtctaagaatgaaactggttagtcctgagactgaggcgagtgaa
gagtctttgcagttcaacctggaaaagcctgcaactggtgaaagaaaaaatggatctact
gctgttgctgagtctgttgccagtccccagaagaccatgtctgtgttgagctgtatctgt
gaagccaggcaagagaatgaggctcgaagtgaggatccccccaccacacccatcaggggg
aacttgctccactttccaagttctcaaggagaagaggagaaagaaaaattggagggtgac
catacaatcaggcagagtcaacagcctatgaagcccattagtcctgtcaaggaccctgtt
tctcctgcttcccagaagatggtcatacaagggccatccagtcctcaaggagaggcaatg
gtgacagatgtgctagaagaccagaaagaaggacggagtactaataaggaaaatcctagt
aaggccttgattgaaaggcccagccaaaataacataggaatccaaaccatggagtgttcc
ttgagggtcccagaaactgtttcagcagcaacccagactataaagaatgtgtgtgagcag
gggaccagtacagtggaccagaactttggaaagcaagatgccacagttcagactgagagg
gggagtggtgagaaaccagtcagtgctcctggggatgatacagagtcgctccatagccag
ggagaagaagagtttgatatgcctcagcctccacatggccatgtcttacatcgtcacatg
agaacaatccgggaagtacgcacacttgtcactcgtgtcattacagatgtgtattatgtg
gatggaacagaagtagaaagaaaagtaactgaggagactgaagagccaattgtagagtgt
caggagtgtgaaactgaagtttccccttcacagactgggggctcctcaggtgacctgggg
gatatcagctccttctcctccaaggcatccagcttacaccgcacatcaagtgggacaagt
ctctcagctatgcacagcagtggaagctcagggaaaggagccggaccactcagagggaaa
accagcgggacagaacccgcagattttgccttacccagctcccgaggaggcccaggaaaa
ctgagtcctagaaaaggggtcagtcagacagggacgccagtgtgtgaggaggatggtgat
gcaggccttggcatcagacagggagggaaggctccagtcacgcctcgtgggcgtgggcga
aggggccgcccaccttctcggaccactggaaccagagaaacagctgtgcctggccccttg
ggcatagaggacatttcacctaacttgtcaccagatgataaatccttcagccgtgtcgtg
ccccgagtgccagactccaccagacgaacagatgtgggtgctggtgctttgcgtcgtagt
gactctccagaaattcctttccaggctgctgctggcccttctgatggcttagatgcctcc
tctccaggaaatagctttgtagggctccgtgttgtagccaagtggtcatccaatggctac
ttttactctgggaaaatcacacgagatgtcggagctgggaagtataaattgctctttgat
gatgggtacgaatgtgatgtgttgggcaaagacattctgttatgtgaccccatcccgctg
gacactgaagtgacggccctctcggaggatgagtatttcagtgcaggagtggtgaaagga
cataggaaggagtctggggaactgtactacagcattgaaaaagaaggccaaagaaagtgg
tataagcgaatggctgtcatcctgtccttggagcaaggaaacagactgagagagcagtat
gggcttggcccctatgaagcagtaacacctcttacaaaggcagcagatatcagcttagac
aatttggtggaagggaagcggaaacggcgcagtaacgtcagctccccagccacccctact
gcctccagtagcagcagcacaacccctacccgaaagatcacagaaagtcctcgtgcctcc
atgggagttctctcaggcaaaagaaaacttatcacttctgaagaggaacggtcccctgcc
aagcgaggtcgcaagtctgccacagtaaaacctggtgcagtaggggcaggagagtttgtg
agcccctgtgagagtggagacaacaccggtgaaccctctgccctggaagagcagagaggg
cctttgcctctcaacaagaccttgtttctgggctacgcatttctccttaccatggccaca
accagtgacaagttggccagccgctccaaactgccagatggtcctacaggaagcagtgaa
gaagaggaggaatttttggaaattcctcctttcaacaagcagtatacagaatcccagctt
cgagcaggagctggctatatccttgaagatttcaatgaagcccagtgtaacacagcttac
cagtgtcttctaattgcggatcagcattgtcgaacccggaagtacttcctgtgccttgcc
agtgggattccttgtgtgtctcatgtctgggtccatgatagttgccatgccaaccagctc
cagaactaccgtaattatctgttgccagctgggtacagccttgaggagcaaagaattctg
gactggcaaccccgtgaaaatcctttccagaatctgaaggtactcttggtatcagaccaa
cagcagaacttcctggagctctggtctgagatcctcatgactggtggtgcagcctctgtg
aagcagcaccattcaagtgcccataacaaagatattgctttaggggtatttgatgtggtg
gtgacggacccctcatgcccagcctcggtgctgaagtgtgctgaagcattgcagctgcct
gtggtgtcacaagagtgggtgatccagtgcctcattgttggggagagaattggattcaag
cagcatccaaaatataaacacgattatgtttctcactaa

DBGET integrated database retrieval system