KEGG   Homo sapiens (human): 7159Help
Entry
7159              CDS       T01001                                 

Gene name
TP53BP2, 53BP2, ASPP2, BBP, P53BP2, PPP1R13A
Definition
(RefSeq) tumor protein p53 binding protein 2
  KO
K16823  apoptosis-stimulating of p53 protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    7159 (TP53BP2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    7159 (TP53BP2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     7159 (TP53BP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_4 Ank_2 Ank Ank_3 SH3_1 SH3_9 Ank_5 SH3_2
Motif
Other DBs
NCBI-GeneID: 7159
NCBI-ProteinID: NP_001026855
OMIM: 602143
HGNC: 12000
Ensembl: ENSG00000143514
Vega: OTTHUMG00000037379
Pharos: Q13625(Tbio)
UniProt: Q13625
Structure
PDB: 

Position
1q41
AA seq 1134 aa AA seqDB search
MRFGSKMMPMFLTVYLSNNEQHFTEVPVTPETICRDVVDLCKEPGESDCHLAEVWCGSER
PVADNERMFDVLQRFGSQRNEVRFFLRHERPPGRDIVSGPRSQDPSLKRNGVKVPGEYRR
KENGVNSPRMDLTLAELQEMASRQQQQIEAQQQLLATKEQRLKFLKQQDQRQQQQVAEQE
KLKRLKEIAENQEAKLKKVRALKGHVEQKRLSNGKLVEEIEQMNNLFQQKQRELVLAVSK
VEELTRQLEMLKNGRIDSHHDNQSAVAELDRLYKELQLRNKLNQEQNAKLQQQRECLNKR
NSEVAVMDKRVNELRDRLWKKKAALQQKENLPVSSDGNLPQQAASAPSRVAAVGPYIQSS
TMPRMPSRPELLVKPALPDGSLVIQASEGPMKIQTLPNMRSGAASQTKGSKIHPVGPDWS
PSNADLFPSQGSASVPQSTGNALDQVDDGEVPLREKEKKVRPFSMFDAVDQSNAPPSFGT
LRKNQSSEDILRDAQVANKNVAKVPPPVPTKPKQINLPYFGQTNQPPSDIKPDGSSQQLS
TVVPSMGTKPKPAGQQPRVLLSPSIPSVGQDQTLSPGSKQESPPAAAVRPFTPQPSKDTL
LPPFRKPQTVAASSIYSMYTQQQAPGKNFQQAVQSALTKTHTRGPHFSSVYGKPVIAAAQ
NQQQHPENIYSNSQGKPGSPEPETEPVSSVQENHENERIPRPLSPTKLLPFLSNPYRNQS
DADLEALRKKLSNAPRPLKKRSSITEPEGPNGPNIQKLLYQRTTIAAMETISVPSYPSKS
ASVTASSESPVEIQNPYLHVEPEKEVVSLVPESLSPEDVGNASTENSDMPAPSPGLDYEP
EGVPDNSPNLQNNPEEPNPEAPHVLDVYLEEYPPYPPPPYPSGEPEGPGEDSVSMRPPEI
TGQVSLPPGKRTNLRKTGSERIAHGMRVKFNPLALLLDSSLEGEFDLVQRIIYEVDDPSL
PNDEGITALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWTPLHCAASCNNVQVCKFLVES
GAAVFAMTYSDMQTAADKCEEMEEGYTQCSQFLYGVQEKMGIMNKGVIYALWDYEPQNDD
ELPMKEGDCMTIIHREDEDEIEWWWARLNDKEGYVPRNLLGLYPRIKPRQRSLA
NT seq 3405 nt NT seq  +upstreamnt  +downstreamnt
atgcggttcgggtccaagatgatgccgatgtttcttaccgtgtatctcagtaacaatgag
cagcacttcacagaagttccagttactccagaaacaatatgcagagacgtggtggatctg
tgcaaagaacccggcgagagtgattgccatttggctgaagtgtggtgtggctctgaacgt
ccagttgcggataatgagcgaatgtttgatgttcttcaacgatttggaagtcagaggaac
gaagttcgcttcttccttcgtcatgaacgcccccctggcagggacattgtgagtggacca
agatctcaggatccaagtttaaaaagaaatggtgtaaaagttcctggtgaatatcgaaga
aaggagaacggtgttaatagtcctaggatggatctgactcttgctgaacttcaggaaatg
gcatctcgccagcagcaacagattgaagcccagcaacaattgctggcaactaaggaacag
cgcttaaagtttttgaaacaacaagatcagcgacaacagcaacaagttgctgagcaggag
aaacttaaaaggctaaaagaaatagctgagaatcaggaagctaagctaaaaaaagtgaga
gcacttaaaggccacgtggaacagaagagactaagcaatgggaaacttgtggaggaaatt
gaacagatgaataatttgttccagcaaaaacagagggagctcgtcctggctgtgtcaaaa
gtagaagaactgaccaggcagctagagatgctcaagaacggcaggatcgacagccaccat
gacaatcagtctgcagtggctgagcttgatcgcctctataaggagctgcagctaagaaac
aaattgaatcaagagcagaatgccaagctacaacaacagagggagtgtttgaataagcgt
aattcagaagtggcagtcatggataagcgtgttaatgagctgagggaccggctgtggaag
aagaaggcagctctacagcaaaaagaaaatctaccagtttcatctgatggaaatcttccc
cagcaagccgcgtcagccccaagccgtgtggctgcagtaggtccctatatccagtcgtct
actatgcctcggatgccctcaaggcctgaattgctggtgaagccagccctgccggatggt
tccttggtcattcaggcttcagaggggccgatgaaaatacagacactgcccaacatgaga
tctggggctgcttcacaaactaaaggctctaaaatccatccagttggccctgattggagt
ccttcaaatgcagatcttttcccaagccaaggctctgcttctgtacctcaaagcactggg
aatgctctggatcaagttgatgatggagaggttccgctgagggagaaagagaagaaagtg
cgtccgttctcaatgtttgatgcagtagaccagtccaatgccccaccttcctttggtact
ctgaggaagaaccagagcagtgaagatatcttgcgggatgctcaggttgcaaataaaaat
gtggctaaagtaccacctcctgttcctacaaaaccaaaacagattaatttgccttatttt
ggacaaactaatcagccaccttcagacattaagccagacggaagttctcagcagttgtca
acagttgttccgtccatgggaactaaaccaaaaccagcagggcagcagccgagagtgctg
ctatctcccagcataccttcggttggccaagaccagaccctttctccaggttctaagcaa
gaaagtccacctgctgctgccgtccggccctttactccccagccttccaaagacacctta
cttccacccttcagaaaaccccagaccgtggcagcaagttcaatatattccatgtatacg
caacagcaggcgccaggaaaaaacttccagcaggctgtgcagagcgcgttgaccaagact
cataccagagggccacacttttcaagtgtatatggtaagcctgtaattgctgctgcccag
aatcaacagcagcacccagagaacatttattccaatagccagggcaagcctggcagtcca
gaacctgaaacagagcctgtttcttcagttcaggagaaccatgaaaacgaaagaattcct
cggccactcagcccaactaaattactgcctttcttatctaatccttaccgaaaccagagt
gatgctgacctagaagccttacgaaagaaactgtctaacgcaccaaggcctctaaagaaa
cgtagttctattacagagccagagggtcctaatgggccaaatattcagaagcttttatat
cagaggaccaccatagcggccatggagaccatctctgtcccatcatacccatccaagtca
gcttctgtgactgccagctcagaaagcccagtagaaatccagaatccatatttacatgtg
gagcccgaaaaggaggtggtctctctggttcctgaatcattgtccccagaggatgtgggg
aatgccagtacagagaacagtgacatgccagctccttctccaggccttgattatgagcct
gagggagtcccagacaacagcccaaatctccagaataacccagaagaaccaaatccagag
gctccacatgtgcttgatgtgtacctggaggagtaccctccatacccacccccaccatac
ccatctggggagcctgaagggcccggagaagactcggtgagcatgcgcccgcctgaaatc
accgggcaggtctctctgcctcctggtaaaaggacaaacttgcgtaaaactggctcagag
cgtatcgctcatggaatgagggtgaaattcaacccccttgctttactgctagattcgtct
ttggagggagaatttgaccttgtacagagaattatttatgaggttgatgacccaagcctc
cccaatgatgaaggcatcacggctcttcacaatgctgtgtgtgcaggccacacagaaatc
gttaagttcctggtacagtttggtgtaaatgtaaatgctgctgatagtgatggatggact
ccattacattgtgctgcctcatgtaacaacgtccaagtgtgtaagtttttggtggagtca
ggagccgctgtgtttgccatgacctacagtgacatgcagactgctgcagataagtgcgag
gaaatggaggaaggctacactcagtgctcccaatttctttatggagttcaggagaagatg
ggcataatgaataaaggagtcatttatgcgctttgggattatgaacctcagaatgatgat
gagctgcccatgaaagaaggagactgcatgacaatcatccacagggaagacgaagatgaa
atcgaatggtggtgggcgcgccttaatgataaggagggatatgttccacgtaacttgctg
ggactgtacccaagaattaaaccaagacaaaggagcttggcctga

DBGET integrated database retrieval system