KEGG   Homo sapiens (human): 716Help
Entry
716               CDS       T01001                                 

Gene name
C1S, EDSPD2
Definition
(RefSeq) complement C1s
  KO
K01331  complement component 1, s subcomponent [EC:3.4.21.42]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05133  Pertussis
hsa05150  Staphylococcus aureus infection
hsa05322  Systemic lupus erythematosus
Disease
H00102  Classic complement pathway component defects
H00802  Ehlers-Danlos syndrome (EDS)
Drug target
Conestat alfa: D10845
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    716 (C1S)
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    716 (C1S)
  Infectious diseases
   05133 Pertussis
    716 (C1S)
   05150 Staphylococcus aureus infection
    716 (C1S)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.42  complement subcomponent C_overbar_1s_
     716 (C1S)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   716 (C1S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin CUB Sushi FXa_inhibition EGF_CA CUB_2 Trypsin_2 hEGF
Motif
Other DBs
NCBI-GeneID: 716
NCBI-ProteinID: NP_001725
OMIM: 120580
HGNC: 1247
Ensembl: ENSG00000182326
Vega: OTTHUMG00000150305
Pharos: P09871(Tchem)
UniProt: P09871
Structure
PDB: 

Position
12p13.31
AA seq 688 aa AA seqDB search
MWCIVLFSLLAWVYAEPTMYGEILSPNYPQAYPSEVEKSWDIEVPEGYGIHLYFTHLDIE
LSENCAYDSVQIISGDTEEGRLCGQRSSNNPHSPIVEEFQVPYNKLQVIFKSDFSNEERF
TGFAAYYVATDINECTDFVDVPCSHFCNNFIGGYFCSCPPEYFLHDDMKNCGVNCSGDVF
TALIGEIASPNYPKPYPENSRCEYQIRLEKGFQVVVTLRREDFDVEAADSAGNCLDSLVF
VAGDRQFGPYCGHGFPGPLNIETKSNALDIIFQTDLTGQKKGWKLRYHGDPMPCPKEDTP
NSVWEPAKAKYVFRDVVQITCLDGFEVVEGRVGATSFYSTCQSNGKWSNSKLKCQPVDCG
IPESIENGKVEDPESTLFGSVIRYTCEEPYYYMENGGGGEYHCAGNGSWVNEVLGPELPK
CVPVCGVPREPFEEKQRIIGGSDADIKNFPWQVFFDNPWAGGALINEYWVLTAAHVVEGN
REPTMYVGSTSVQTSRLAKSKMLTPEHVFIHPGWKLLEVPEGRTNFDNDIALVRLKDPVK
MGPTVSPICLPGTSSDYNLMDGDLGLISGWGRTEKRDRAVRLKAARLPVAPLRKCKEVKV
EKPTADAEAYVFTPNMICAGGEKGMDSCKGDSGGAFAVQDPNDKTKFYAAGLVSWGPQCG
TYGLYTRVKNYVDWIMKTMQENSTPRED
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgtggtgcattgtcctgttttcacttttggcatgggtttatgctgagcctaccatgtat
ggggagatcctgtcccctaactatcctcaggcatatcccagtgaggtagagaaatcttgg
gacatagaagttcctgaagggtatgggattcacctctacttcacccatctggacattgag
ctgtcagagaactgtgcgtatgactcagtgcagataatctcaggagacactgaagaaggg
aggctctgtggacagaggagcagtaacaatccccactctccaattgtggaagagttccaa
gtcccatacaacaaactccaggtgatctttaagtcagacttttccaatgaagagcgtttt
acggggtttgctgcatactatgttgccacagacataaatgaatgcacagattttgtagat
gtcccttgtagccacttctgcaacaatttcattggtggttacttctgctcctgccccccg
gaatatttcctccatgatgacatgaagaattgcggagttaattgcagtggggatgtattc
actgcactgattggggagattgcaagtcccaattatcccaaaccatatccagagaactca
aggtgtgaataccagatccggttggagaaagggttccaagtggtggtgaccttgcggaga
gaagattttgatgtggaagcagctgactcagcgggaaactgccttgacagtttagttttt
gttgcaggagatcggcaatttggtccttactgtggtcatggattccctgggcctctaaat
attgaaaccaagagtaatgctcttgatatcatcttccaaactgatctaacagggcaaaaa
aagggctggaaacttcgctatcatggagatccaatgccctgccctaaggaagacactccc
aattctgtttgggagcctgcgaaggcaaaatatgtctttagagatgtggtgcagataacc
tgtctggatgggtttgaagttgtggagggacgtgttggtgcaacatctttctattcgact
tgtcaaagcaatggaaagtggagtaattccaaactgaaatgtcaacctgtggactgtggc
attcctgaatccattgagaatggtaaagttgaagacccagagagcactttgtttggttct
gtcatccgctacacttgtgaggagccatattactacatggaaaatggaggaggtggggag
tatcactgtgctggtaacgggagctgggtgaatgaggtgctgggcccggagctgccgaaa
tgtgttccagtctgtggagtccccagagaaccctttgaagaaaaacagaggataattgga
ggatccgatgcagatattaaaaacttcccctggcaagtcttctttgacaacccatgggct
ggtggagcgctcattaatgagtactgggtgctgacggctgctcatgttgtggagggaaac
agggagccaacaatgtatgttgggtccacctcagtgcagacctcacggctggcaaaatcc
aagatgctcactcctgagcatgtgtttattcatccgggatggaagctgctggaagtccca
gaaggacgaaccaattttgataatgacattgcactggtgcggctgaaagacccagtgaaa
atgggacccaccgtctctcccatctgcctaccaggcacctcttccgactacaacctcatg
gatggggacctgggactgatctcaggctggggccgaacagagaagagagatcgtgctgtt
cgcctcaaggcggcaaggttacctgtagctcctttaagaaaatgcaaagaagtgaaagtg
gagaaacccacagcagatgcagaggcctatgttttcactcctaacatgatctgtgctgga
ggagagaagggcatggatagctgtaaaggggacagtggtggggcctttgctgtacaggat
cccaatgacaagaccaaattctacgcagctggcctggtgtcctgggggccccagtgtggg
acctatgggctctacacacgggtaaagaactatgttgactggataatgaagactatgcag
gaaaatagcaccccccgtgaggactaa

DBGET integrated database retrieval system