KEGG   Homo sapiens (human): 7161Help
Entry
7161              CDS       T01001                                 

Gene name
TP73, P73
Definition
(RefSeq) tumor protein p73
  KO
K10148  tumor protein p73
Organism
hsa  Homo sapiens (human)
Pathway
hsa04115  p53 signaling pathway
hsa04390  Hippo signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa05162  Measles
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    7161 (TP73)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    7161 (TP73)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    7161 (TP73)
 09160 Human Diseases
  09167 Infectious diseases
   05162 Measles
    7161 (TP73)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7161 (TP73)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   p53
    7161 (TP73)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P53 P53_tetramer SAM_2 SAM_1
Motif
Other DBs
NCBI-GeneID: 7161
NCBI-ProteinID: NP_005418
OMIM: 601990
HGNC: 12003
Ensembl: ENSG00000078900
Vega: OTTHUMG00000000610
Pharos: O15350(Tbio)
UniProt: O15350 A0A024R4C3
Structure
PDB: 

Position
1p36.32
AA seq 636 aa AA seqDB search
MAQSTATSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMDVFHLEGMTTS
VMAQFNLLSSTMDQMSSRAASASPYTPEHAASVPTHSPYAQPSSTFDTMSPAPVIPSNTD
YPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPV
YKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPY
EPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGR
DRKADEDHYREQQALNESSAKNGAASKRAFKQSPPAVPALGAGVKKRRHGDEDTYYLQVR
GRENFEILMKLKESLELMELVPQPLVDSYRQQQQLLQRPSHLQPPSYGPVLSPMNKVHGG
MNKLPSVNQLVGQPPPHSSAATPNLGPVGPGMLNNHGHAVPANGEMSSSHSAQSMVSGSH
CTPPPPYHADPSLVSFLTGLGCPNCIEYFTSQGLQSIYHLQNLTIEDLGALKIPEQYRMT
IWRGLQDLKQGHDYSTAQQLLRSSNAATISIGGSGELQRQRVMEAVHFRVRHTITIPNRG
GPGGGPDEWADFGFDLPDCKARKQPIKEEFTEAEIH
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atggcccagtccaccgccacctcccctgatgggggcaccacgtttgagcacctctggagc
tctctggaaccagacagcacctacttcgaccttccccagtcaagccgggggaataatgag
gtggtgggcggaacggattccagcatggacgtcttccacctggagggcatgactacatct
gtcatggcccagttcaatctgctgagcagcaccatggaccagatgagcagccgcgcggcc
tcggccagcccctacaccccagagcacgccgccagcgtgcccacccactcgccctacgca
caacccagctccaccttcgacaccatgtcgccggcgcctgtcatcccctccaacaccgac
taccccggaccccaccactttgaggtcactttccagcagtccagcacggccaagtcagcc
acctggacgtactccccgctcttgaagaaactctactgccagatcgccaagacatgcccc
atccagatcaaggtgtccaccccgccacccccaggcaccgccatccgggccatgcctgtt
tacaagaaagcggagcacgtgaccgacgtcgtgaaacgctgccccaaccacgagctcggg
agggacttcaacgaaggacagtctgctccagccagccacctcatccgcgtggaaggcaat
aatctctcgcagtatgtggatgaccctgtcaccggcaggcagagcgtcgtggtgccctat
gagccaccacaggtggggacggaattcaccaccatcctgtacaacttcatgtgtaacagc
agctgtgtagggggcatgaaccggcggcccatcctcatcatcatcaccctggagatgcgg
gatgggcaggtgctgggccgccggtcctttgagggccgcatctgcgcctgtcctggccgc
gaccgaaaagctgatgaggaccactaccgggagcagcaggccctgaacgagagctccgcc
aagaacggggccgccagcaagcgtgccttcaagcagagcccccctgccgtccccgccctt
ggtgccggtgtgaagaagcggcggcatggagacgaggacacgtactaccttcaggtgcga
ggccgggagaactttgagatcctgatgaagctgaaagagagcctggagctgatggagttg
gtgccgcagccactggtggactcctatcggcagcagcagcagctcctacagaggccgagt
cacctacagcccccgtcctacgggccggtcctctcgcccatgaacaaggtgcacgggggc
atgaacaagctgccctccgtcaaccagctggtgggccagcctcccccgcacagttcggca
gctacacccaacctggggcccgtgggccccgggatgctcaacaaccatggccacgcagtg
ccagccaacggcgagatgagcagcagccacagcgcccagtccatggtctcggggtcccac
tgcactccgccacccccctaccacgccgaccccagcctcgtcagttttttaacaggattg
gggtgtccaaactgcatcgagtatttcacctcccaagggttacagagcatttaccacctg
cagaacctgaccattgaggacctgggggccctgaagatccccgagcagtaccgcatgacc
atctggcggggcctgcaggacctgaagcagggccacgactacagcaccgcgcagcagctg
ctccgctctagcaacgcggccaccatctccatcggcggctcaggggaactgcagcgccag
cgggtcatggaggccgtgcacttccgcgtgcgccacaccatcaccatccccaaccgcggc
ggcccaggcggcggccctgacgagtgggcggacttcggcttcgacctgcccgactgcaag
gcccgcaagcagcccatcaaggaggagttcacggaggccgagatccactga

DBGET integrated database retrieval system