KEGG   Homo sapiens (human): 7162Help
Entry
7162              CDS       T01001                                 

Gene name
TPBG, 5T4, 5T4AG, M6P1, WAIF1
Definition
(RefSeq) trophoblast glycoprotein
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_1 LRRNT LRRCT LRR_9 LRR_6
Motif
Other DBs
NCBI-GeneID: 7162
NCBI-ProteinID: NP_001159864
OMIM: 190920
HGNC: 12004
Ensembl: ENSG00000146242
Vega: OTTHUMG00000015103
Pharos: Q13641(Tbio)
UniProt: Q13641
Structure
PDB: 

Position
6q14.1
AA seq 420 aa AA seqDB search
MPGGCSRGPAAGDGRLRLARLALVLLGWVSSSSPTSSASSFSSSAPFLASAVSAQPPLPD
QCPALCECSEAARTVKCVNRNLTEVPTDLPAYVRNLFLTGNQLAVLPAGAFARRPPLAEL
AALNLSGSRLDEVRAGAFEHLPSLRQLDLSHNPLADLSPFAFSGSNASVSAPSPLVELIL
NHIVPPEDERQNRSFEGMVVAALLAGRALQGLRRLELASNHFLYLPRDVLAQLPSLRHLD
LSNNSLVSLTYVSFRNLTHLESLHLEDNALKVLHNGTLAELQGLPHIRVFLDNNPWVCDC
HMADMVTWLKETEVVQGKDRLTCAYPEKMRNRVLLELNSADLDCDPILPPSLQTSYVFLG
IVLALIGAIFLLVLYLNRKGIKKWMHNIRDACRDHMEGYHYRYEINADPRLTNLSSNSDV
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgcctggggggtgctcccggggccccgccgccggggacgggcgtctgcggctggcgcga
ctagcgctggtactcctgggctgggtctcctcgtcttctcccacctcctcggcatcctcc
ttctcctcctcggcgccgttcctggcttccgccgtgtccgcccagcccccgctgccggac
cagtgccccgcgctgtgcgagtgctccgaggcagcgcgcacagtcaagtgcgttaaccgc
aatctgaccgaggtgcccacggacctgcccgcctacgtgcgcaacctcttccttaccggc
aaccagctggccgtgctccctgccggcgccttcgcccgccggccgccgctggcggagctg
gccgcgctcaacctcagcggcagccgcctggacgaggtgcgcgcgggcgccttcgagcat
ctgcccagcctgcgccagctcgacctcagccacaacccactggccgacctcagtcccttc
gctttctcgggcagcaatgccagcgtctcggcccccagtccccttgtggaactgatcctg
aaccacatcgtgccccctgaagatgagcggcagaaccggagcttcgagggcatggtggtg
gcggccctgctggcgggccgtgcactgcaggggctccgccgcttggagctggccagcaac
cacttcctttacctgccgcgggatgtgctggcccaactgcccagcctcaggcacctggac
ttaagtaataattcgctggtgagcctgacctacgtgtccttccgcaacctgacacatcta
gaaagcctccacctggaggacaatgccctcaaggtccttcacaatggcaccctggctgag
ttgcaaggtctaccccacattagggttttcctggacaacaatccctgggtctgcgactgc
cacatggcagacatggtgacctggctcaaggaaacagaggtagtgcagggcaaagaccgg
ctcacctgtgcatatccggaaaaaatgaggaatcgggtcctcttggaactcaacagtgct
gacctggactgtgacccgattcttcccccatccctgcaaacctcttatgtcttcctgggt
attgttttagccctgataggcgctattttcctcctggttttgtatttgaaccgcaagggg
ataaaaaagtggatgcataacatcagagatgcctgcagggatcacatggaagggtatcat
tacagatatgaaatcaatgcggaccccagattaacgaacctcagttctaactcggatgtc
tga

DBGET integrated database retrieval system