KEGG   Homo sapiens (human): 7167Help
Entry
7167              CDS       T01001                                 

Gene name
TPI1, HEL-S-49, TIM, TPI, TPID
Definition
(RefSeq) triosephosphate isomerase 1
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00051  Fructose and mannose metabolism
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01230  Biosynthesis of amino acids
Module
hsa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hsa_M00002  Glycolysis, core module involving three-carbon compounds
hsa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Disease
H00664  Anemia due to disorders of glycolytic enzymes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    7167 (TPI1)
   00051 Fructose and mannose metabolism
    7167 (TPI1)
   00562 Inositol phosphate metabolism
    7167 (TPI1)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     7167 (TPI1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   7167 (TPI1)
  Exosomal proteins of bladder cancer cells
   7167 (TPI1)
  Exosomal proteins of melanoma cells
   7167 (TPI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 7167
NCBI-ProteinID: NP_001152759
OMIM: 190450
HGNC: 12009
Ensembl: ENSG00000111669
Vega: OTTHUMG00000133767
Pharos: P60174(Tbio)
UniProt: P60174
Structure
PDB: 

Position
12p13.31
AA seq 286 aa AA seqDB search
MAEDGEEAEFHFAALYISGQWPRLRADTDLQRLGSSAMAPSRKFFVGGNWKMNGRKQSLG
ELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKIAVAAQNCYKVTNGAFTGEISPGM
IKDCGATWVVLGHSERRHVFGESDELIGQKVAHALAEGLGVIACIGEKLDEREAGITEKV
VFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQQAQEVHEKLRGWLKSNVSDAVAQ
STRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPEFVDIINAKQ
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggacggcgaggaggcggagttccacttcgcggcgctctatataagtgggcag
tggccgcgactgcgcgcagacactgaccttcagcgcctcggctccagcgccatggcgccc
tccaggaagttcttcgttgggggaaactggaagatgaacgggcggaagcagagtctgggg
gagctcatcggcactctgaacgcggccaaggtgccggccgacaccgaggtggtttgtgct
ccccctactgcctatatcgacttcgcccggcagaagctagatcccaagattgctgtggct
gcgcagaactgctacaaagtgactaatggggcttttactggggagatcagccctggcatg
atcaaagactgcggagccacgtgggtggtcctggggcactcagagagaaggcatgtcttt
ggggagtcagatgagctgattgggcagaaagtggcccatgctctggcagagggactcgga
gtaatcgcctgcattggggagaagctagatgaaagggaagctggcatcactgagaaggtt
gttttcgagcagacaaaggtcatcgcagataacgtgaaggactggagcaaggtcgtcctg
gcctatgagcctgtgtgggccattggtactggcaagactgcaacaccccaacaggcccag
gaagtacacgagaagctccgaggatggctgaagtccaacgtctctgatgcggtggctcag
agcacccgtatcatttatggaggctctgtgactggggcaacctgcaaggagctggccagc
cagcctgatgtggatggcttccttgtgggtggtgcttccctcaagcccgaattcgtggac
atcatcaatgccaaacaatga

DBGET integrated database retrieval system