KEGG   Homo sapiens (human): 7169Help
Entry
7169              CDS       T01001                                 

Gene name
TPM2, AMCD1, DA1, DA2B, HEL-S-273, NEM4, TMSB
Definition
(RefSeq) tropomyosin 2
  KO
K10374  tropomyosin 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04260  Cardiac muscle contraction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05414  Dilated cardiomyopathy (DCM)
Disease
H00698  Nemaline myopathy
H00702  Cap myopathy
H00811  Distal arthrogryposis (DA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    7169 (TPM2)
   04261 Adrenergic signaling in cardiomyocytes
    7169 (TPM2)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    7169 (TPM2)
   05414 Dilated cardiomyopathy (DCM)
    7169 (TPM2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     7169 (TPM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tropomyosin Tropomyosin_1 CLZ Laminin_II YscO ERM TMF_DNA_bd Cluap1 Reo_sigmaC IncA CENP-F_leu_zip MscS_porin HrpB7 Snapin_Pallidin ATG16 SlyX DUF1664 DUF16 FlaC_arch Golgin_A5 HOOK APG6 ADIP Spc7 XhlA Suppressor_APC
Motif
Other DBs
NCBI-GeneID: 7169
NCBI-ProteinID: NP_003280
OMIM: 190990
HGNC: 12011
Ensembl: ENSG00000198467
Vega: OTTHUMG00000019878
Pharos: P07951(Tbio)
UniProt: P07951
Position
9p13.3
AA seq 284 aa AA seqDB search
MDAIKKKMQMLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQALQKKLKGTEDEVEKY
SESVKEAQEKLEQAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIENRAMKDEEKMELQEMQLKEAKHIAEDSDRKYEEVARKLVILEGELERSE
ERAEVAESKCGDLEEELKIVTNNLKSLEAQADKYSTKEDKYEEEIKLLEEKLKEAETRAE
FAERSVAKLEKTIDDLEDEVYAQKMKYKAISEELDNALNDITSL
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcagatgctgaagctggacaaggagaacgccatcgac
cgcgccgagcaggccgaagccgacaagaagcaagctgaggaccgctgcaagcagctggag
gaggagcagcaggccctccagaagaagctgaaggggacagaggatgaggtggaaaagtat
tctgaatccgtgaaggaggcccaggagaaactggagcaggccgagaagaaggccactgat
gctgaggcagatgtggcctccctgaaccgccgcattcagctggttgaggaggagctggac
cgggcccaggagcgcctggctacagccctgcagaagctggaggaggccgagaaggcggct
gatgagagcgagagaggaatgaaggtcatcgaaaaccgggccatgaaggatgaggagaag
atggaactgcaggagatgcagctgaaggaggccaagcacatcgctgaggattcagaccgc
aaatatgaagaggtggccaggaagctggtgatcctggaaggagagctggagcgctcggag
gagagggctgaggtggccgagagtaaatgtggggacctagaggaggagctgaaaattgtt
accaacaacttgaaatccctggaggcccaggcggacaagtattccaccaaagaagataaa
tatgaagaggagatcaaactgttggaggagaagctgaaggaggctgagacccgagcagag
tttgccgagaggtctgtggcaaagttggagaaaaccatcgatgacctagaagatgaagtc
tatgcccagaagatgaagtacaaggccattagcgaggaactggacaacgcactcaatgac
atcacctccctctga

DBGET integrated database retrieval system