KEGG   Homo sapiens (human): 717Help
Entry
717               CDS       T01001                                 

Gene name
C2, ARMD14, CO2
Definition
(RefSeq) complement C2
  KO
K01332  complement component 2 [EC:3.4.21.43]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05133  Pertussis
hsa05150  Staphylococcus aureus infection
hsa05322  Systemic lupus erythematosus
Disease
H00080  Systemic lupus erythematosus
H00102  Classic complement pathway component defects
H00821  Age-related macular degeneration
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    717 (C2)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    717 (C2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    717 (C2)
   05150 Staphylococcus aureus infection
    717 (C2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    717 (C2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.43  classical-complement-pathway C3/C5 convertase
     717 (C2)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   717 (C2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VWA Trypsin Sushi VWA_2 DUF1986 HRM Trypsin_2
Motif
Other DBs
NCBI-GeneID: 717
NCBI-ProteinID: NP_000054
OMIM: 613927
HGNC: 1248
Ensembl: ENSG00000166278
Vega: OTTHUMG00000031190
Pharos: P06681(Tbio)
UniProt: P06681 Q5JP69 Q53HP3
Structure
PDB: 

Position
6p21.33
AA seq 752 aa AA seqDB search
MGPLMVLFCLLFLYPGLADSAPSCPQNVNISGGTFTLSHGWAPGSLLTYSCPQGLYPSPA
SRLCKSSGQWQTPGATRSLSKAVCKPVRCPAPVSFENGIYTPRLGSYPVGGNVSFECEDG
FILRGSPVRQCRPNGMWDGETAVCDNGAGHCPNPGISLGAVRTGFRFGHGDKVRYRCSSN
LVLTGSSERECQGNGVWSGTEPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKES
LGRKIQIQRSGHLNLYLLLDCSQSVSENDFLIFKESASLMVDRIFSFEINVSVAIITFAS
EPKVLMSVLNDNSRDMTEVISSLENANYKDHENGTGTNTYAALNSVYLMMNNQMRLLGME
TMAWQEIRHAIILLTDGKSNMGGSPKTAVDHIREILNINQKRNDYLDIYAIGVGKLDVDW
RELNELGSKKDGERHAFILQDTKALHQVFEHMLDVSKLTDTICGVGNMSANASDQERTPW
HVTIKPKSQETCRGALISDQWVLTAAHCFRDGNDHSLWRVNVGDPKSQWGKEFLIEKAVI
SPGFDVFAKKNQGILEFYGDDIALLKLAQKVKMSTHARPICLPCTMEANLALRRPQGSTC
RDHENELLNKQSVPAHFVALNGSKLNINLKMGVEWTSCAEVVSQEKTMFPNLTDVREVVT
DQFLCSGTQEDESPCKGESGGAVFLERRFRFFQVGLVSWGLYNPCLGSADKNSRKRAPRS
KVPPPRDFHINLFRMQPWLRQHLGDVLNFLPL
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgggcccactgatggttcttttttgcctgctgttcctgtacccaggtctggcagactcg
gctccctcctgccctcagaacgtgaatatctcgggtggcaccttcaccctcagccatggc
tgggctcctgggagccttctcacctactcctgcccccagggcctgtacccatccccagca
tcacggctgtgcaagagcagcggacagtggcagaccccaggagccacccggtctctgtct
aaggcggtctgcaaacctgtgcgctgtccagcccctgtctcctttgagaatggcatttat
accccacggctggggtcctatcccgtgggtggcaatgtgagcttcgagtgtgaggatggc
ttcatattgcggggctcgcctgtgcgtcagtgtcgccccaacggcatgtgggatggagaa
acagctgtgtgtgataatggggctggccactgccccaacccaggcatttcactgggcgca
gtgcggacaggcttccgctttggtcatggggacaaggtccgctatcgctgctcctcgaat
cttgtgctcacggggtcttcggagcgggagtgccagggcaacggggtctggagtggaacg
gagcccatctgccgccaaccctactcttatgacttccctgaggacgtggcccctgccctg
ggcacttccttctcccacatgcttggggccaccaatcccacccagaagacaaaggaaagc
ctgggccgtaaaatccaaatccagcgctctggtcatctgaacctctacctgctcctggac
tgttcgcagagtgtgtcggaaaatgactttctcatcttcaaggagagcgcctccctcatg
gtggacaggatcttcagctttgagatcaatgtgagcgttgccattatcacctttgcctca
gagcccaaagtcctcatgtctgtcctgaacgacaactcccgggatatgactgaggtgatc
agcagcctggaaaatgccaactataaagatcatgaaaatggaactgggactaacacctat
gcggccttaaacagtgtctatctcatgatgaacaaccaaatgcgactcctcggcatggaa
acgatggcctggcaggaaatccgacatgccatcatccttctgacagatggaaagtccaat
atgggtggctctcccaagacagctgttgaccatatcagagagatcctgaacatcaaccag
aagaggaatgactatctggacatctatgccatcggggtgggcaagctggatgtggactgg
agagaactgaatgagctagggtccaagaaggatggtgagaggcatgccttcattctgcag
gacacaaaggctctgcaccaggtctttgaacatatgctggatgtctccaagctcacagac
accatctgcggggtggggaacatgtcagcaaacgcctctgaccaggagaggacaccctgg
catgtcactattaagcccaagagccaagagacctgccggggggccctcatctccgaccaa
tgggtcctgacagcagctcattgcttccgcgatggcaacgaccactccctgtggagggtc
aatgtgggagaccccaaatcccagtggggcaaagaattccttattgagaaggcggtgatc
tccccagggtttgatgtctttgccaaaaagaaccagggaatcctggagttctatggtgat
gacatagctctgctgaagctggcccagaaagtaaagatgtccacccatgccaggcccatc
tgccttccctgcacgatggaggccaatctggctctgcggagacctcaaggcagcacctgt
agggaccatgagaatgaactgctgaacaaacagagtgttcctgctcattttgtcgccttg
aatgggagcaaactgaacattaaccttaagatgggagtggagtggacaagctgtgccgag
gttgtctcccaagaaaaaaccatgttccccaacttgacagatgtcagggaggtggtgaca
gaccagttcctatgcagtgggacccaggaggatgagagtccctgcaagggagaatctggg
ggagcagttttccttgagcggagattcaggttttttcaggtgggtctggtgagctggggt
ctttacaacccctgccttggctctgctgacaaaaactcccgcaaaagggcccctcgtagc
aaggtcccgccgccacgagactttcacatcaatctcttccgcatgcagccctggctgagg
cagcacctgggggatgtcctgaattttttacccctctag

DBGET integrated database retrieval system