KEGG   Homo sapiens (human): 7170Help
Entry
7170              CDS       T01001                                 

Gene name
TPM3, CAPM1, CFTD, HEL-189, HEL-S-82p, NEM1, OK/SW-cl.5, TM-5, TM3, TM30, TM30nm, TM5, TPM3nu, TPMsk3, TRK, hscp30
Definition
(RefSeq) tropomyosin 3
  KO
K09290  tropomyosin 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04260  Cardiac muscle contraction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa05200  Pathways in cancer
hsa05216  Thyroid cancer
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05414  Dilated cardiomyopathy (DCM)
Disease
H00032  Thyroid cancer
H00698  Nemaline myopathy
H00701  Congenital fiber type disproportion
H00702  Cap myopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    7170 (TPM3)
   04261 Adrenergic signaling in cardiomyocytes
    7170 (TPM3)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    7170 (TPM3)
  09162 Cancers: Specific types
   05216 Thyroid cancer
    7170 (TPM3)
  09166 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    7170 (TPM3)
   05414 Dilated cardiomyopathy (DCM)
    7170 (TPM3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    7170 (TPM3)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     7170 (TPM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II CLZ ERM TMF_DNA_bd XhlA DUF745 CENP-F_leu_zip ATG16 HrpB7 DHR10 SlyX DUF1664 AAA_13 Lebercilin Laminin_I DUF16 MAD
Motif
Other DBs
NCBI-GeneID: 7170
NCBI-ProteinID: NP_689476
OMIM: 191030
HGNC: 12012
Ensembl: ENSG00000143549
Vega: OTTHUMG00000035853
Pharos: P06753(Tbio)
UniProt: P06753
Position
1q21.3
AA seq 285 aa AA seqDB search
MMEAIKKKMQMLKLDKENALDRAEQAEAEQKQAEERSKQLEDELAAMQKKLKGTEDELDK
YSEALKDAQEKLELAEKKAADAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKA
ADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERT
EERAELAESKCSELEEELKNVTNNLKSLEAQAEKYSQKEDKYEEEIKILTDKLKEAETRA
EFAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDHALNDMTSI
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgatggaggccatcaagaaaaagatgcagatgctgaagttagacaaggagaatgctctg
gatcgggcagagcaagctgaagctgagcagaagcaggcagaagaaagaagtaaacagctg
gaggatgagctggcagccatgcagaagaagctgaaagggacagaggatgagctggacaag
tattctgaagctttgaaggatgcccaggagaagctggaactggcagagaagaaggctgct
gatgctgaggctgaggtggcctccttgaaccgtaggatccagctggttgaagaagagctg
gaccgtgctcaggagcgcctggccactgccctgcaaaagctggaagaagctgaaaaagct
gctgatgagagtgagagaggtatgaaggttattgaaaaccgggccttaaaagatgaagaa
aagatggaactccaggaaatccaactcaaagaagctaagcacattgcagaagaggcagat
aggaagtatgaagaggtggctcgtaagttggtgatcattgaaggagacttggaacgcaca
gaggaacgagctgagctggcagagtctaagtgttctgagctggaggaggagctgaagaat
gtcaccaacaacctcaagtctcttgaggctcaggcggagaagtactctcaaaaagaagat
aaatatgaggaagaaatcaagattcttactgataaactcaaggaggcagagacccgtgct
gagtttgctgagagatcggtagccaagctggaaaagacaattgatgacctggaagatgag
ctctatgcccagaaactgaagtacaaggccattagcgaggagctggaccacgccctcaat
gacatgacctctatataa

DBGET integrated database retrieval system