KEGG   Homo sapiens (human): 7178Help
Entry
7178              CDS       T01001                                 

Gene name
TPT1, HRF, TCTP, p02, p23
Definition
(RefSeq) tumor protein, translationally-controlled 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: TCTP Endotoxin_N
Motif
Other DBs
NCBI-GeneID: 7178
NCBI-ProteinID: NP_003286
OMIM: 600763
HGNC: 12022
Ensembl: ENSG00000133112
Vega: OTTHUMG00000016845
Pharos: P13693(Tbio)
UniProt: P13693 A0A0P1J1R0
Structure
PDB: 

Position
13q14.13
AA seq 172 aa AA seqDB search
MIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGE
GTESTVITGVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAE
QIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgattatctaccgggacctcatcagccacgatgagatgttctccgacatctacaagatc
cgggagatcgcggacgggttgtgcctggaggtggaggggaagatggtcagtaggacagaa
ggtaacattgatgactcgctcattggtggaaatgcctccgctgaaggccccgagggcgaa
ggtaccgaaagcacagtaatcactggtgtcgatattgtcatgaaccatcacctgcaggaa
acaagtttcacaaaagaagcctacaagaagtacatcaaagattacatgaaatcaatcaaa
gggaaacttgaagaacagagaccagaaagagtaaaaccttttatgacaggggctgcagaa
caaatcaagcacatccttgctaatttcaaaaactaccagttctttattggtgaaaacatg
aatccagatggcatggttgctctattggactaccgtgaggatggtgtgaccccatatatg
attttctttaaggatggtttagaaatggaaaaatgttaa

DBGET integrated database retrieval system