KEGG   Homo sapiens (human): 7181
Entry
7181              CDS       T01001                                 
Symbol
NR2C1, TR2
Name
(RefSeq) nuclear receptor subfamily 2 group C member 1
  KO
K08543  testicular receptor 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7181 (NR2C1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    7181 (NR2C1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    7181 (NR2C1)
Nuclear receptors [BR:hsa03310]
 2. Hepatocyte nuclear factor 4 like
  2C. Testicular receptor
   7181 (NR2C1)
SSDB
Motif
Pfam: Hormone_recep zf-C4 FtrD-like
Other DBs
NCBI-GeneID: 7181
NCBI-ProteinID: NP_003288
OMIM: 601529
HGNC: 7971
Ensembl: ENSG00000120798
UniProt: P13056 H9NIM2
Position
12:complement(95020229..95073618)
AA seq 603 aa
MATIEEIAHQIIEQQMGEIVTEQQTGQKIQIVTALDHNTQGKQFILTNHDGSTPSKVILA
RQDSTPGKVFLTTPDAAGVNQLFFTTPDLSAQHLQLLTDNSPDQGPNKVFDLCVVCGDKA
SGRHYGAVTCEGCKGFFKRSIRKNLVYSCRGSKDCIINKHHRNRCQYCRLQRCIAFGMKQ
DSVQCERKPIEVSREKSSNCAASTEKIYIRKDLRSPLTATPTFVTDSESTRSTGLLDSGM
FMNIHPSGVKTESAVLMTSDKAESCQGDLSTLANVVTSLANLGKTKDLSQNSNEMSMIES
LSNDDTSLCEFQEMQTNGDVSRAFDTLAKALNPGESTACQSSVAGMEGSVHLITGDSSIN
YTEKEGPLLSDSHVAFRLTMPSPMPEYLNVHYIGESASRLLFLSMHWALSIPSFQALGQE
NSISLVKAYWNELFTLGLAQCWQVMNVATILATFVNCLHNSLQQDKMSTERRKLLMEHIF
KLQEFCNSMVKLCIDGYEYAYLKAIVLFSPDHPSLENMEQIEKFQEKAYVEFQDYITKTY
PDDTYRLSRLLLRLPALRLMNATITEELFFKGLIGNIRIDSVIPHILKMEPADYNSQIIG
HSI
NT seq 1812 nt   +upstreamnt  +downstreamnt
atggcaaccatagaagaaattgcacatcaaattattgaacaacagatgggagagattgtt
acagagcagcaaactgggcagaaaatccagattgtgacagcacttgatcataatacccaa
ggcaagcagttcattctgacaaatcacgacggctctactccaagcaaagtcattctggcc
aggcaagattccactccgggaaaagttttccttacaactccagatgcagcaggtgtcaac
cagttattttttaccactcctgatctgtctgcacaacacctgcagctcctaacagataat
tctccagaccaaggaccaaataaggtttttgatctttgcgtagtatgtggagacaaagca
tcaggacgtcattatggagcagtaacttgtgaaggctgcaaaggattttttaaaagaagc
atccgaaaaaatttagtatattcatgtcgaggatcaaaggattgtattattaataagcac
caccgaaaccgctgtcaatactgcaggttacagagatgtattgcgtttggaatgaagcaa
gactctgtccaatgtgaaagaaaacccattgaagtatcacgagaaaaatcttccaactgt
gccgcttcaacagaaaaaatctatatccgaaaggaccttcgtagcccattaactgcaact
ccaacttttgtaacagatagtgaaagtacaaggtcaacaggactgttagattcaggaatg
ttcatgaatattcatccatctggagtaaaaactgagtcagctgtgctgatgacatcagat
aaggctgaatcatgtcagggagatttaagtacattggccaatgtggttacatcattagcg
aatcttggaaaaactaaagatctttctcaaaatagtaatgaaatgtctatgattgaaagc
ttaagcaatgatgatacctctttgtgtgaatttcaagaaatgcagaccaacggtgatgtt
tcaagggcatttgacactcttgcaaaagcattgaatcctggagagagcacagcctgccag
agctcagtagcgggcatggaaggaagtgtacacctaatcactggagattcaagcataaat
tacaccgaaaaagaggggccacttctcagcgattcacatgtagctttcaggctcaccatg
ccttctcctatgcctgagtacctgaatgtgcactacattggggagtctgcctccagactg
ctgttcttatcaatgcactgggcactttcgattccttctttccaggctctagggcaagaa
aacagcatatcactggtgaaagcttactggaatgaactttttactcttggtcttgcccag
tgctggcaagtgatgaatgtagcaactatattagcaacatttgtcaattgtcttcacaat
agtcttcaacaagataaaatgtcaacagaaagaagaaaattattgatggagcacatcttc
aaactacaggagttttgtaacagcatggttaaactctgcattgatggatacgaatatgcc
tacctgaaggcaatagtactcttcagtccagatcatccaagcctagaaaacatggaacag
atagagaaatttcaggaaaaggcttatgtggaattccaagattatataaccaaaacatat
ccagatgacacctacaggttatccagactactactcagattgccagctttaagactgatg
aatgctaccatcactgaagaattgtttttcaaaggtctcattggcaatatacgaattgac
agtgttatcccacatattttgaaaatggagcctgcagattataactctcaaataattggt
cacagcatttga

DBGET integrated database retrieval system