KEGG   Homo sapiens (human): 7182Help
Entry
7182              CDS       T01001                                 

Gene name
NR2C2, TAK1, TR4
Definition
(RefSeq) nuclear receptor subfamily 2 group C member 2
  KO
K08544  testicular receptor 4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7182 (NR2C2)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    7182 (NR2C2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    7182 (NR2C2)
Nuclear receptors [BR:hsa03310]
 2. Hepatocyte nuclear factor 4 like
  2C. Testicular receptor
   7182 (NR2C2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep zf-C4 Flagellin_N
Motif
Other DBs
NCBI-GeneID: 7182
NCBI-ProteinID: NP_001278623
OMIM: 601426
HGNC: 7972
Ensembl: ENSG00000177463
Vega: OTTHUMG00000129839
Pharos: P49116(Tchem)
UniProt: P49116
Structure
PDB: 

Position
3p25.1
AA seq 596 aa AA seqDB search
MTSPSPRIQIISTDSAVASPQRIQIVTDQQTGQKIQIVTAVDASGSPKQQFILTSPDGAG
TGKVILASPETSSAKQLIFTTSDNLVPGRIQIVTDSASVERLLGKTDVQRPQVVEYCVVC
GDKASGRHYGAVSCEGCKGFFKRSVRKNLTYSCRSNQDCIINKHHRNRCQFCRLKKCLEM
GMKMESVQSERKPFDVQREKPSNCAASTEKIYIRKDLRSPLIATPTFVADKDGARQTGLL
DPGMLVNIQQPLIREDGTVLLATDSKAETSQGALGTLANVVTSLANLSESLNNGDTSEIQ
PEDQSASEITRAFDTLAKALNTTDSSSSPSLADGIDTSGGGSIHVISRDQSTPIIEVEGP
LLSDTHVTFKLTMPSPMPEYLNVHYICESASRLLFLSMHWARSIPAFQALGQDCNTSLVR
ACWNELFTLGLAQCAQVMSLSTILAAIVNHLQNSIQEDKLSGDRIKQVMEHIWKLQEFCN
SMAKLDIDGYEYAYLKAIVLFSPDHPGLTSTSQIEKFQEKAQMELQDYVQKTYSEDTYRL
ARILVRLPALRLMSSNITEELFFTGLIGNVSIDSIIPYILKMETAEYNGQITGASL
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcccctccccacgcatccagataatctccaccgactctgctgtagcctcacct
cagcgcattcagattgtcacagaccagcagacaggacagaaaatccagatagtcaccgca
gtggacgcctccggatcccccaaacagcagttcatcctgaccagcccagatggagctgga
actgggaaggtgatcctggcttccccagagacatccagcgccaagcaactcatattcacc
acctcagacaacctcgtccctggcaggatccagattgtcacggattctgcctctgtggag
cgtttactggggaagacggacgtccagcggccccaggtggtagagtactgtgtggtctgt
ggcgacaaagcctccggccgtcactatggggctgtcagttgtgaaggttgcaaaggtttc
ttcaaaaggagtgtgaggaaaaatttgacctacagctgccggagcaaccaagactgcatc
atcaataaacatcaccggaaccgctgtcagttttgccggctgaaaaaatgcttagagatg
ggcatgaaaatggaatctgtgcagagtgaacggaagcccttcgatgtgcaacgggagaaa
ccaagcaattgtgctgcttcaactgagaaaatctatatccggaaagacctgagaagtccc
ctgatagctactcccacgtttgtggcagacaaagatggagcaagacaaacaggtcttctt
gatccagggatgcttgtgaacatccagcagcctttgatacgtgaggatggtacagttctc
ctggccacggattctaaggctgaaacaagccagggagctctgggcacactggcaaatgta
gtgacctcccttgccaacctaagtgaatctttgaacaacggtgacacttcagaaatccag
ccagaggaccagtctgcaagtgagataactcgggcatttgataccttagctaaagcactt
aataccacagacagctcctcttctccaagcttggcagatgggatagacaccagtggagga
gggagcatccacgtcatcagcagagaccagtcgacacccatcattgaggttgaaggcccc
ctcctttcagacacacacgtcacatttaagctaacaatgcccagtccaatgccagagtac
ctcaacgtgcactacatctgtgagtctgcatcccgtctgcttttcctctcaatgcactgg
gctcggtcaatcccagcctttcaggcacttgggcaggactgcaacaccagccttgtgcgg
gcctgctggaatgagctcttcaccctcggcctggcccagtgtgcccaggtcatgagtctc
tccaccatcctggctgccattgtcaaccacctgcagaacagcatccaggaagataaactt
tctggtgaccggataaagcaagtcatggagcacatctggaagctgcaggagttctgtaac
agcatggcgaagctggatatagatggctatgagtatgcataccttaaagctatagttctc
tttagccccgatcatccaggtttgaccagcacaagccagattgaaaaattccaagaaaag
gcacagatggagttgcaggactatgttcagaaaacctactcagaagacacctaccgattg
gcccggatcctcgttcgcctgccggcactcaggctgatgagctccaacataacagaagaa
cttttttttactggtctcattggcaatgtttcgatagacagcataatcccctacatcctc
aagatggagacagcagagtataatggccagatcaccggagccagtctatag

DBGET integrated database retrieval system