KEGG   Homo sapiens (human): 7184Help
Entry
7184              CDS       T01001                                 

Gene name
HSP90B1, ECGP, GP96, GRP94, HEL-S-125m, HEL35, TRA1
Definition
(RefSeq) heat shock protein 90 beta family member 1
  KO
K09487  heat shock protein 90kDa beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa04151  PI3K-Akt signaling pathway
hsa04657  IL-17 signaling pathway
hsa04915  Estrogen signaling pathway
hsa04918  Thyroid hormone synthesis
hsa05200  Pathways in cancer
hsa05215  Prostate cancer
hsa05418  Fluid shear stress and atherosclerosis
Drug target
Ganetespib: D10126
Luminespib (DG01842): D10646 D10647
Onalespib: D10719
Retaspimycin (DG01880): D09375 D09376
Tanespimycin: D06650
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    7184 (HSP90B1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    7184 (HSP90B1)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    7184 (HSP90B1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    7184 (HSP90B1)
   04918 Thyroid hormone synthesis
    7184 (HSP90B1)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    7184 (HSP90B1)
   05215 Prostate cancer
    7184 (HSP90B1)
  09165 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    7184 (HSP90B1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    7184 (HSP90B1)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP90
   7184 (HSP90B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 DUF4518 MH1
Motif
Other DBs
NCBI-GeneID: 7184
NCBI-ProteinID: NP_003290
OMIM: 191175
HGNC: 12028
Ensembl: ENSG00000166598
Vega: OTTHUMG00000170118
Pharos: P14625(Tchem)
UniProt: P14625 V9HWP2
Structure
PDB: 

Position
12q23.3
AA seq 803 aa AA seqDB search
MRALWVLGLCCVLLTFGSVRADDEVDVDGTVEEDLGKSREGSRTDDEVVQREEEAIQLDG
LNASQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISL
TDENALSGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTE
AQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNT
LGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTETVEEPMEEEEAAK
EEKEESDDEAAVEEEEEEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEVEEDEYKAFYK
SFSKESDDPMAYIHFTAEGEVTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITD
DFHDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADDKY
NDTFWKEFGTNIKLGVIEDHSNRTRLAKLLRFQSSHHPTDITSLDQYVERMKEKQDKIYF
MAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDE
SEKTKESREAVEKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMER
IMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRIKEDEDDKTVLDLAVVLFET
ATLRSGYLLPDTKAYGDRIERMLRLSLNIDPDAKVEEEPEEEPEETAEDTTEDTEQDEDE
EMDVGTDEEEETAKESTAEKDEL
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atgagggccctgtgggtgctgggcctctgctgcgtcctgctgaccttcgggtcggtcaga
gctgacgatgaagttgatgtggatggtacagtagaagaggatctgggtaaaagtagagaa
ggatcaaggacggatgatgaagtagtacagagagaggaagaagctattcagttggatgga
ttaaatgcatcacaaataagagaacttagagagaagtcggaaaagtttgccttccaagcc
gaagttaacagaatgatgaaacttatcatcaattcattgtataaaaataaagagattttc
ctgagagaactgatttcaaatgcttctgatgctttagataagataaggctaatatcactg
actgatgaaaatgctctttctggaaatgaggaactaacagtcaaaattaagtgtgataag
gagaagaacctgctgcatgtcacagacaccggtgtaggaatgaccagagaagagttggtt
aaaaaccttggtaccatagccaaatctgggacaagcgagtttttaaacaaaatgactgaa
gcacaggaagatggccagtcaacttctgaattgattggccagtttggtgtcggtttctat
tccgccttccttgtagcagataaggttattgtcacttcaaaacacaacaacgatacccag
cacatctgggagtctgactccaatgaattttctgtaattgctgacccaagaggaaacact
ctaggacggggaacgacaattacccttgtcttaaaagaagaagcatctgattaccttgaa
ttggatacaattaaaaatctcgtcaaaaaatattcacagttcataaactttcctatttat
gtatggagcagcaagactgaaactgttgaggagcccatggaggaagaagaagcagccaaa
gaagagaaagaagaatctgatgatgaagctgcagtagaggaagaagaagaagaaaagaaa
ccaaagactaaaaaagttgaaaaaactgtctgggactgggaacttatgaatgatatcaaa
ccaatatggcagagaccatcaaaagaagtagaagaagatgaatacaaagctttctacaaa
tcattttcaaaggaaagtgatgaccccatggcttatattcactttactgctgaaggggaa
gttaccttcaaatcaattttatttgtacccacatctgctccacgtggtctgtttgacgaa
tatggatctaaaaagagcgattacattaagctctatgtgcgccgtgtattcatcacagac
gacttccatgatatgatgcctaaatacctcaattttgtcaagggtgtggtggactcagat
gatctccccttgaatgtttcccgcgagactcttcagcaacataaactgcttaaggtgatt
aggaagaagcttgttcgtaaaacgctggacatgatcaagaagattgctgatgataaatac
aatgatactttttggaaagaatttggtaccaacatcaagcttggtgtgattgaagaccac
tcgaatcgaacacgtcttgctaaacttcttaggttccagtcttctcatcatccaactgac
attactagcctagaccagtatgtggaaagaatgaaggaaaaacaagacaaaatctacttc
atggctgggtccagcagaaaagaggctgaatcttctccatttgttgagcgacttctgaaa
aagggctatgaagttatttacctcacagaacctgtggatgaatactgtattcaggccctt
cccgaatttgatgggaagaggttccagaatgttgccaaggaaggagtgaagttcgatgaa
agtgagaaaactaaggagagtcgtgaagcagttgagaaagaatttgagcctctgctgaat
tggatgaaagataaagcccttaaggacaagattgaaaaggctgtggtgtctcagcgcctg
acagaatctccgtgtgctttggtggccagccagtacggatggtctggcaacatggagaga
atcatgaaagcacaagcgtaccaaacgggcaaggacatctctacaaattactatgcgagt
cagaagaaaacatttgaaattaatcccagacacccgctgatcagagacatgcttcgacga
attaaggaagatgaagatgataaaacagttttggatcttgctgtggttttgtttgaaaca
gcaacgcttcggtcagggtatcttttaccagacactaaagcatatggagatagaatagaa
agaatgcttcgcctcagtttgaacattgaccctgatgcaaaggtggaagaagagcccgaa
gaagaacctgaagagacagcagaagacacaacagaagacacagagcaagacgaagatgaa
gaaatggatgtgggaacagatgaagaagaagaaacagcaaaggaatctacagctgaaaaa
gatgaattgtaa

DBGET integrated database retrieval system