KEGG   Homo sapiens (human): 7184Help
Entry
7184              CDS       T01001                                 

Gene name
HSP90B1, ECGP, GP96, GRP94, HEL-S-125m, HEL35, TRA1
Definition
(RefSeq) heat shock protein 90 beta family member 1
  KO
K09487  heat shock protein 90kDa beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa04151  PI3K-Akt signaling pathway
hsa04657  IL-17 signaling pathway
hsa04915  Estrogen signaling pathway
hsa04918  Thyroid hormone synthesis
hsa05200  Pathways in cancer
hsa05215  Prostate cancer
hsa05418  Fluid shear stress and atherosclerosis
Drug target
Alvespimycin hydrochloride: D06554
Ganetespib: D10126
Luminespib (DG01842): D10646 D10647
Onalespib: D10719
Retaspimycin (DG01880): D09375 D09376
Tanespimycin: D06650
Vitespen: D06667
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    7184 (HSP90B1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    7184 (HSP90B1)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    7184 (HSP90B1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    7184 (HSP90B1)
   04918 Thyroid hormone synthesis
    7184 (HSP90B1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    7184 (HSP90B1)
  09162 Cancers: Specific types
   05215 Prostate cancer
    7184 (HSP90B1)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    7184 (HSP90B1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    7184 (HSP90B1)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP90
   7184 (HSP90B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 DUF4518 MH1
Motif
Other DBs
NCBI-GeneID: 7184
NCBI-ProteinID: NP_003290
OMIM: 191175
HGNC: 12028
Ensembl: ENSG00000166598
Vega: OTTHUMG00000170118
Pharos: P14625(Tchem)
UniProt: P14625 V9HWP2
Structure
PDB: 

Position
12q23.3
AA seq 803 aa AA seqDB search
MRALWVLGLCCVLLTFGSVRADDEVDVDGTVEEDLGKSREGSRTDDEVVQREEEAIQLDG
LNASQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISL
TDENALSGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTE
AQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNT
LGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTETVEEPMEEEEAAK
EEKEESDDEAAVEEEEEEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEVEEDEYKAFYK
SFSKESDDPMAYIHFTAEGEVTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITD
DFHDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADDKY
NDTFWKEFGTNIKLGVIEDHSNRTRLAKLLRFQSSHHPTDITSLDQYVERMKEKQDKIYF
MAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDE
SEKTKESREAVEKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMER
IMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRIKEDEDDKTVLDLAVVLFET
ATLRSGYLLPDTKAYGDRIERMLRLSLNIDPDAKVEEEPEEEPEETAEDTTEDTEQDEDE
EMDVGTDEEEETAKESTAEKDEL
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atgagggccctgtgggtgctgggcctctgctgcgtcctgctgaccttcgggtcggtcaga
gctgacgatgaagttgatgtggatggtacagtagaagaggatctgggtaaaagtagagaa
ggatcaaggacggatgatgaagtagtacagagagaggaagaagctattcagttggatgga
ttaaatgcatcacaaataagagaacttagagagaagtcggaaaagtttgccttccaagcc
gaagttaacagaatgatgaaacttatcatcaattcattgtataaaaataaagagattttc
ctgagagaactgatttcaaatgcttctgatgctttagataagataaggctaatatcactg
actgatgaaaatgctctttctggaaatgaggaactaacagtcaaaattaagtgtgataag
gagaagaacctgctgcatgtcacagacaccggtgtaggaatgaccagagaagagttggtt
aaaaaccttggtaccatagccaaatctgggacaagcgagtttttaaacaaaatgactgaa
gcacaggaagatggccagtcaacttctgaattgattggccagtttggtgtcggtttctat
tccgccttccttgtagcagataaggttattgtcacttcaaaacacaacaacgatacccag
cacatctgggagtctgactccaatgaattttctgtaattgctgacccaagaggaaacact
ctaggacggggaacgacaattacccttgtcttaaaagaagaagcatctgattaccttgaa
ttggatacaattaaaaatctcgtcaaaaaatattcacagttcataaactttcctatttat
gtatggagcagcaagactgaaactgttgaggagcccatggaggaagaagaagcagccaaa
gaagagaaagaagaatctgatgatgaagctgcagtagaggaagaagaagaagaaaagaaa
ccaaagactaaaaaagttgaaaaaactgtctgggactgggaacttatgaatgatatcaaa
ccaatatggcagagaccatcaaaagaagtagaagaagatgaatacaaagctttctacaaa
tcattttcaaaggaaagtgatgaccccatggcttatattcactttactgctgaaggggaa
gttaccttcaaatcaattttatttgtacccacatctgctccacgtggtctgtttgacgaa
tatggatctaaaaagagcgattacattaagctctatgtgcgccgtgtattcatcacagac
gacttccatgatatgatgcctaaatacctcaattttgtcaagggtgtggtggactcagat
gatctccccttgaatgtttcccgcgagactcttcagcaacataaactgcttaaggtgatt
aggaagaagcttgttcgtaaaacgctggacatgatcaagaagattgctgatgataaatac
aatgatactttttggaaagaatttggtaccaacatcaagcttggtgtgattgaagaccac
tcgaatcgaacacgtcttgctaaacttcttaggttccagtcttctcatcatccaactgac
attactagcctagaccagtatgtggaaagaatgaaggaaaaacaagacaaaatctacttc
atggctgggtccagcagaaaagaggctgaatcttctccatttgttgagcgacttctgaaa
aagggctatgaagttatttacctcacagaacctgtggatgaatactgtattcaggccctt
cccgaatttgatgggaagaggttccagaatgttgccaaggaaggagtgaagttcgatgaa
agtgagaaaactaaggagagtcgtgaagcagttgagaaagaatttgagcctctgctgaat
tggatgaaagataaagcccttaaggacaagattgaaaaggctgtggtgtctcagcgcctg
acagaatctccgtgtgctttggtggccagccagtacggatggtctggcaacatggagaga
atcatgaaagcacaagcgtaccaaacgggcaaggacatctctacaaattactatgcgagt
cagaagaaaacatttgaaattaatcccagacacccgctgatcagagacatgcttcgacga
attaaggaagatgaagatgataaaacagttttggatcttgctgtggttttgtttgaaaca
gcaacgcttcggtcagggtatcttttaccagacactaaagcatatggagatagaatagaa
agaatgcttcgcctcagtttgaacattgaccctgatgcaaaggtggaagaagagcccgaa
gaagaacctgaagagacagcagaagacacaacagaagacacagagcaagacgaagatgaa
gaaatggatgtgggaacagatgaagaagaagaaacagcaaaggaatctacagctgaaaaa
gatgaattgtaa

DBGET integrated database retrieval system