KEGG   Homo sapiens (human): 7186Help
Entry
7186              CDS       T01001                                 

Gene name
TRAF2, MGC:45012, RNF117, TRAP, TRAP3
Definition
(RefSeq) TNF receptor associated factor 2
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa04210  Apoptosis
hsa04217  Necroptosis
hsa04380  Osteoclast differentiation
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05160  Hepatitis C
hsa05163  Human cytomegalovirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05222  Small cell lung cancer
Network
N00173  KSHV K15 to NFKB signaling pathway
N00174  KSHV vFLIP to TNF-NFKB signaling pathway
N00265  EBV LMP1 to host-cell-protein activation
N00441  HIV gp120 to TNF-NFKB signaling pathway
N00442  HIV Nef to TNF-NFKB signaling pathway
N00444  TNF-p38 signaling pathway
N00446  TNF-JNK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    7186 (TRAF2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    7186 (TRAF2)
   04064 NF-kappa B signaling pathway
    7186 (TRAF2)
   04668 TNF signaling pathway
    7186 (TRAF2)
   04071 Sphingolipid signaling pathway
    7186 (TRAF2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    7186 (TRAF2)
   04217 Necroptosis
    7186 (TRAF2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    7186 (TRAF2)
   04622 RIG-I-like receptor signaling pathway
    7186 (TRAF2)
   04657 IL-17 signaling pathway
    7186 (TRAF2)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    7186 (TRAF2)
  09158 Development
   04380 Osteoclast differentiation
    7186 (TRAF2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    7186 (TRAF2)
   05203 Viral carcinogenesis
    7186 (TRAF2)
  09162 Cancers: Specific types
   05222 Small cell lung cancer
    7186 (TRAF2)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    7186 (TRAF2)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    7186 (TRAF2)
   05160 Hepatitis C
    7186 (TRAF2)
   05168 Herpes simplex infection
    7186 (TRAF2)
   05163 Human cytomegalovirus infection
    7186 (TRAF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    7186 (TRAF2)
   05169 Epstein-Barr virus infection
    7186 (TRAF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    7186 (TRAF2)
   04121 Ubiquitin system [BR:hsa04121]
    7186 (TRAF2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     7186 (TRAF2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     7186 (TRAF2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    7186 (TRAF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAF_BIRC3_bd zf-TRAF zf-C3HC4 Reo_sigmaC zf-C3HC4_2 zf-RING_6 zf-C3HC4_4 MATH SlyX DUF1664
Motif
Other DBs
NCBI-GeneID: 7186
NCBI-ProteinID: NP_066961
OMIM: 601895
HGNC: 12032
Ensembl: ENSG00000127191
Vega: OTTHUMG00000020952
Pharos: Q12933(Tbio)
UniProt: Q12933 A0A024R8H5
Structure
PDB: 

Position
9q34.3
AA seq 501 aa AA seqDB search
MAAASVTPPGSLELLQPGFSKTLLGTKLEAKYLCSACRNVLRRPFQAQCGHRYCSFCLAS
ILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLKE
YESCHEGRCPLMLTECPACKGLVRLGEKERHLEHECPERSLSCRHCRAPCCGADVKAHHE
VCPKFPLTCDGCGKKKIPREKFQDHVKTCGKCRVPCRFHAIGCLETVEGEKQQEHEVQWL
REHLAMLLSSVLEAKPLLGDQSHAGSELLQRCESLEKKTATFENIVCVLNREVERVAMTA
EACSRQHRLDQDKIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISD
FARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDA
LLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEA
KNSYVRDDAIFIKAIVDLTGL
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagctagcgtgaccccccctggctccctggagttgctacagcccggcttctcc
aagaccctcctggggaccaagctggaagccaagtacctgtgctccgcctgcagaaacgtc
ctccgcaggcccttccaggcgcagtgtggccaccggtactgctccttctgcctggccagc
atcctcagctctgggcctcagaactgtgctgcctgtgttcacgagggcatatatgaagaa
ggcatttctattttagaaagcagttcggccttcccagataatgctgcccgcagggaggtg
gagagcctgccggccgtctgtcccagtgatggatgcacctggaaggggaccctgaaagaa
tacgagagctgccacgaaggccgctgcccgctcatgctgaccgaatgtcccgcgtgcaaa
ggcctggtccgccttggtgaaaaggagcgccacctggagcacgagtgcccggagagaagc
ctgagctgccggcattgccgggcaccctgctgcggagcagacgtgaaggcgcaccacgag
gtctgccccaagttccccttaacttgtgacggctgcggcaagaagaagatcccccgggag
aagtttcaggaccacgtcaagacttgtggcaagtgtcgagtcccttgcagattccacgcc
atcggctgcctcgagacggtagagggtgagaaacagcaggagcacgaggtgcagtggctg
cgggagcacctggccatgctactgagctcggtgctggaggcaaagcccctcttgggagac
cagagccacgcggggtcagagctcctgcagaggtgcgagagcctggagaagaagacggcc
acttttgagaacattgtctgcgtcctgaaccgggaggtggagagggtggccatgactgcc
gaggcctgcagccggcagcaccggctggaccaagacaagattgaagccctgagtagcaag
gtgcagcagctggagaggagcattggcctcaaggacctggcgatggctgacttggagcag
aaggtcttggagatggaggcatccacctacgatggggtcttcatctggaagatctcagac
ttcgccaggaagcgccaggaagctgtggctggccgcatacccgccatcttctccccagcc
ttctacaccagcaggtacggctacaagatgtgtctgcgtatctacctgaacggcgacggc
accgggcgaggaacacacctgtccctcttctttgtggtgatgaagggcccgaatgacgcc
ctgctgcggtggcccttcaaccagaaggtgaccttaatgctgctcgaccagaataaccgg
gagcacgtgattgacgccttcaggcccgacgtgacttcatcctcttttcagaggccagtc
aacgacatgaacatcgcaagcggctgccccctcttctgccccgtctccaagatggaggca
aagaattcctacgtgcgggacgatgccatcttcatcaaggccattgtggacctgacaggg
ctctaa

DBGET integrated database retrieval system