KEGG   Homo sapiens (human): 7187Help
Entry
7187              CDS       T01001                                 

Gene name
TRAF3, CAP-1, CAP1, CD40bp, CRAF1, IIAE5, LAP1, RNF118
Definition
(RefSeq) TNF receptor associated factor 3
  KO
K03174  TNF receptor-associated factor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa05160  Hepatitis C
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05222  Small cell lung cancer
Network
N00148  TLR3-IRF7 signaling pathway
N00149  TLR3-IRF3 signaling pathway
N00265  EBV LMP1 to host-cell-protein activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    7187 (TRAF3)
   04668 TNF signaling pathway
    7187 (TRAF3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    7187 (TRAF3)
   04621 NOD-like receptor signaling pathway
    7187 (TRAF3)
   04622 RIG-I-like receptor signaling pathway
    7187 (TRAF3)
   04657 IL-17 signaling pathway
    7187 (TRAF3)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    7187 (TRAF3)
   05203 Viral carcinogenesis
    7187 (TRAF3)
   05222 Small cell lung cancer
    7187 (TRAF3)
  09167 Infectious diseases
   05160 Hepatitis C
    7187 (TRAF3)
   05168 Herpes simplex infection
    7187 (TRAF3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    7187 (TRAF3)
   05169 Epstein-Barr virus infection
    7187 (TRAF3)
   05165 Human papillomavirus infection
    7187 (TRAF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-TRAF MPS2 zf-C3HC4 Spc7 Spc29 Tropomyosin_1 zf-C3HC4_2 ATG16 IncA T3SSipB FliJ KxDL CENP-Q BLOC1_2 Mnd1 Fib_alpha DUF1664 LMBR1 SPATA24 DUF3450 V_ATPase_I ADIP
Motif
Other DBs
NCBI-GeneID: 7187
NCBI-ProteinID: NP_003291
OMIM: 601896
HGNC: 12033
Ensembl: ENSG00000131323
Vega: OTTHUMG00000171902
Pharos: Q13114(Tbio)
UniProt: Q13114
Structure
PDB: 

Position
14q32.32
AA seq 568 aa AA seqDB search
MESSKKMDSPGALQTNPPLKLHTDRSAGTPVFVPEQGGYKEKFVKTVEDKYKCEKCHLVL
CSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNE
SRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHC
KSQVPMIALQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCV
FQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEI
EIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNR
VTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIW
KIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRG
EYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQ
TVLENGTYIKDDTIFIKVIVDTSDLPDP
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgagtaaaaagatggactctcctggcgcgctgcagactaacccgccgctaaag
ctgcacactgaccgcagtgctgggacgccagtttttgtccctgaacaaggaggttacaag
gaaaagtttgtgaagaccgtggaggacaagtacaagtgtgagaagtgccacctggtgctg
tgcagcccgaagcagaccgagtgtgggcaccgcttctgcgagagctgcatggcggccctg
ctgagctcttcaagtccaaaatgtacagcgtgtcaagagagcatcgttaaagataaggtg
tttaaggataattgctgcaagagagaaattctggctcttcagatctattgtcggaatgaa
agcagaggttgtgcagagcagttaatgctgggacatctgctggtgcatttaaaaaatgat
tgccattttgaagaacttccatgtgtgcgtcctgactgcaaagaaaaggtcttgaggaaa
gacctgcgagaccacgtggagaaggcgtgtaaataccgggaagccacatgcagccactgc
aagagtcaggttccgatgatcgcgctgcagaaacacgaagacaccgactgtccctgcgtg
gtggtgtcctgccctcacaagtgcagcgtccagactctcctgaggagcgagttgagtgca
cacttgtcagagtgtgtcaatgcccccagcacctgtagttttaagcgctatggctgcgtt
tttcaggggacaaaccagcagatcaaggcccacgaggccagctccgccgtgcagcacgtc
aacctgctgaaggagtggagcaactcgctcgaaaagaaggtttccttgttgcagaatgaa
agtgtagaaaaaaacaagagcatacaaagtttgcacaatcagatatgtagctttgaaatt
gaaattgagagacaaaaggaaatgcttcgaaataatgaatccaaaatccttcatttacag
cgagtgatagacagccaagcagagaaactgaaggagcttgacaaggagatccggcccttc
cggcagaactgggaggaagcagacagcatgaagagcagcgtggagtccctccagaaccgc
gtgaccgagctggagagcgtggacaagagcgcggggcaagtggctcggaacacaggcctg
ctggagtcccagctgagccggcatgaccagatgctgagtgtgcacgacatccgcctagcc
gacatggacctgcgcttccaggtcctggagaccgccagctacaatggagtgctcatctgg
aagattcgcgactacaagcggcggaagcaggaggccgtcatggggaagaccctgtccctt
tacagccagcctttctacactggttactttggctataagatgtgtgccagggtctacctg
aacggggacgggatggggaaggggacgcacttgtcgctgttttttgtcatcatgcgtgga
gaatatgatgccctgcttccttggccgtttaagcagaaagtgacactcatgctgatggat
caggggtcctctcgacgtcatttgggagatgcattcaagcccgaccccaacagcagcagc
ttcaagaagcccactggagagatgaatatcgcctctggctgcccagtctttgtggcccaa
actgttctagaaaatgggacatatattaaagatgatacaatttttattaaagtcatagtg
gatacttcggatctgcccgatccctga

DBGET integrated database retrieval system