KEGG   Homo sapiens (human): 72Help
Entry
72                CDS       T01001                                 

Gene name
ACTG2, ACT, ACTA3, ACTE, ACTL3, ACTSG, VSCM
Definition
(RefSeq) actin gamma 2, smooth muscle
  KO
K12315  actin, gamma-enteric smooth muscle
Organism
hsa  Homo sapiens (human)
Pathway
hsa04270  Vascular smooth muscle contraction
Disease
H01869  Megacystis microcolon intestinal hypoperistalsis syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    72 (ACTG2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    72 (ACTG2)
   04147 Exosome [BR:hsa04147]
    72 (ACTG2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     72 (ACTG2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   72 (ACTG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin
Motif
Other DBs
NCBI-GeneID: 72
NCBI-ProteinID: NP_001606
OMIM: 102545
HGNC: 145
Ensembl: ENSG00000163017
Vega: OTTHUMG00000129813
Pharos: P63267(Tbio)
UniProt: P63267
Position
2p13.1
AA seq 376 aa AA seqDB search
MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
SKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKM
TQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLD
LAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKS
YELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVL
SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK
PEYDEAGPSIVHRKCF
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgaagaggagaccaccgcgctcgtgtgtgacaatggctctggcctgtgcaaggca
ggcttcgcaggagatgatgccccccgggctgtcttcccctccattgtgggccgccctcgc
caccagggtgtgatggtgggaatgggccagaaagacagctatgtgggggatgaggctcag
agcaagcgagggatcctaactctcaaataccccattgaacacggcatcatcaccaactgg
gatgacatggagaagatctggcaccactccttctacaatgagctgcgtgtagcacctgaa
gagcaccccaccctgctcacagaggctcccctaaatcccaaggccaacagggaaaagatg
acccagatcatgtttgaaaccttcaatgtccctgccatgtacgtcgccattcaagctgtg
ctctccctctatgcctctggccgcacgacaggcatcgtcctggattcaggtgatggcgtc
acccacaatgtccccatctatgaaggctatgccctgccccatgccatcatgcgcctggac
ttggctggccgtgacctcacggactacctcatgaagatcctcacagagagaggctattcc
tttgtgaccacagctgagagagaaattgtgcgagacatcaaggagaagctgtgctatgtg
gccctggattttgagaatgagatggccacagcagcttcctcttcctccctggagaagagc
tatgagctgccagatgggcaggttatcaccattggcaatgagcgcttccgctgccctgag
accctcttccagccttcctttattggcatggagtccgctggaattcatgagacaacctac
aattccatcatgaagtgtgacattgacatccgtaaggacttatatgccaacaatgtcctc
tctgggggcaccaccatgtaccctggcattgctgacaggatgcagaaggagatcacagcc
ctggcccccagcaccatgaagatcaagattattgctcccccagagcggaagtactcagtc
tggatcgggggctctatcctggcctctctctccaccttccagcagatgtggatcagcaag
cctgagtatgatgaggcagggccctccattgtccacaggaagtgcttctaa

DBGET integrated database retrieval system