KEGG   Homo sapiens (human): 7200Help
Entry
7200              CDS       T01001                                 

Gene name
TRH, Pro-TRH, TRF
Definition
(RefSeq) thyrotropin releasing hormone
  KO
K05253  thyrotropin-releasing hormone
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Network
nt06322  TRH-TSH-TH signaling
  Element
N00918  TRH-TRHR-PLCB-PKC signaling pathway
N00919  Mutation-inactivated TRHR to PLCB-PKC signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    7200 (TRH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRH BSP_II
Motif
Other DBs
NCBI-GeneID: 7200
NCBI-ProteinID: NP_009048
OMIM: 613879
HGNC: 12298
Ensembl: ENSG00000170893
Vega: OTTHUMG00000159634
Pharos: P20396(Tbio)
CPD: C03958
UniProt: P20396
Position
3q22.1
AA seq 242 aa AA seqDB search
MPGPWLLLALALTLNLTGVPGGRAQPEAAQQEAVTAAEHPGLDDFLRQVERLLFLRENIQ
RLQGDQGEHSASQIFQSDWLSKRQHPGKREEEEEEGVEEEEEEEGGAVGPHKRQHPGRRE
DEASWSVDVTQHKRQHPGRRSPWLAYAVPKRQHPGRRLADPKAQRSWEEEEEEEEREEDL
MPEKRQHPGKRALGGPCGPQGAYGQAGLLLGLLDDLSRSQGAEEKRQHPGRRAAWVREPL
EE
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgcccggcccttggttgctgctcgctctggctttgaccctgaacctgaccggtgtcccc
ggcggccgtgctcagccagaggcggcccagcaggaggcagtgacggccgcggagcatccg
ggcctggatgacttcctgcgccaggtggagcgcctcctcttcctccgggaaaacatccag
cggctgcaaggggaccagggtgagcactccgcgtcccagatctttcaatctgactggctc
tccaaacgtcagcatccaggcaaaagagaggaggaggaggaagagggagttgaagaagag
gaagaggaagaagggggggctgtgggaccccacaaacggcagcaccctggccgacgagaa
gatgaggcttcatggtcagtcgatgtaacccagcacaagcggcagcatcctggccggcgc
tccccctggcttgcatatgctgtcccgaagcggcagcacccaggcagaaggctggcagat
cccaaggctcaaaggagctgggaagaagaggaggaggaggaagagagagaggaagacctg
atgcctgaaaaacgccagcatccgggcaagagggccctgggaggcccctgtgggccccag
ggagcctatggtcaagcgggccttctgctggggctcctggatgacctgagtaggagccag
ggagctgaggaaaagcggcagcaccctggtcggcgggcagcctgggtcagagagcccctg
gaggagtga

DBGET integrated database retrieval system