KEGG   Homo sapiens (human): 7201Help
Entry
7201              CDS       T01001                                 

Gene name
TRHR, CHNG7, TRH-R
Definition
(RefSeq) thyrotropin releasing hormone receptor
  KO
K04282  thyrotropin-releasing hormone receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
Network
nt06322  TRH-TSH-TH signaling
  Element
N00918  TRH-TRHR-PLCB-PKC signaling pathway
N00919  Mutation-inactivated TRHR to PLCB-PKC signaling pathway
Disease
H00250  Congenital nongoitrous hypothyroidism (CHNG)
H01700  Hypopituitarism
Drug target
Montirelin (DG01347): D02588 D09845
Protirelin (DG01171): D00176 D02007
Rovatirelin hydrate: D10594
Taltirelin hydrate: D01925
Thyrotropin alfa: D06120
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    7201 (TRHR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    7201 (TRHR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    7201 (TRHR)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Thyrotropin-releasing hormone (TRH)
    7201 (TRHR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 7201
NCBI-ProteinID: NP_003292
OMIM: 188545
HGNC: 12299
Ensembl: ENSG00000174417
Vega: OTTHUMG00000164910
Pharos: P34981(Tclin)
UniProt: P34981
Position
8q23.1
AA seq 398 aa AA seqDB search
MENETVSELNQTQLQPRAVVALEYQVVTILLVLIICGLGIVGNIMVVLVVMRTKHMRTPT
NCYLVSLAVADLMVLVAAGLPNITDSIYGSWVYGYVGCLCITYLQYLGINASSCSITAFT
IERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSLYCMLWFFLLDLNISTYKDAIVISCG
YKISRNYYSPIYLMDFGVFYVVPMILATVLYGFIARILFLNPIPSDPKENSKTWKNDSTH
QNTNLNVNTSNRCFNSTVSSRKQVTKMLAVVVILFALLWMPYRTLVVVNSFLSSPFQENW
FLLFCRICIYLNSAINPVIYNLMSQKFRAAFRKLCNCKQKPTEKPANYSVALNYSVIKES
DHFSTELDDITVTDTYLSATKVSFDDTCLASEVSFSQS
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacgagacagtcagtgaactgaaccaaacacagcttcagccacgagcagtggtg
gccttagaataccaggtggtcaccatcttacttgtactcattatttgtggcctgggcatt
gtaggcaacatcatggtagtcctggttgtcatgagaaccaagcacatgaggacccccaca
aactgctacctggtgagcctggcagtagctgatctcatggtcttggtggccgcaggcctc
cccaacataacagacagtatctacggttcctgggtctatggctatgttggatgcctctgc
attacttacctccagtatttgggaattaatgcatcctcttgttcaataacagcctttacc
attgagaggtacatagcaatctgtcaccccatcaaagcccagtttctctgcacattttcc
agagccaaaaagattatcatctttgtctgggctttcacatctctttactgtatgctctgg
ttcttcttgctggatctcaatattagcacctacaaagatgctattgtgatatcctgtggc
tacaagatctccaggaattactactcacctatttacctaatggactttggtgtcttttat
gttgtgccaatgatcctggctaccgtcctctatggattcatagctagaatccttttctta
aatcccattccttcagatcctaaagaaaactctaagacatggaaaaatgattcaacccat
cagaacacaaatctgaatgtaaatacctctaatagatgtttcaacagcacagtatcttca
aggaagcaggtcaccaagatgctggcagtggttgtaattctgtttgcccttttatggatg
ccctacaggactctagtggttgtcaactcatttctctccagtcctttccaagaaaattgg
tttttgctcttttgcagaatttgcatttatctcaacagtgccatcaacccggtgatttac
aatctcatgtcccagaaattccgtgcagccttcagaaagctctgcaactgcaagcagaag
ccaacagagaaacctgctaactacagtgtggccctaaattacagcgtcatcaaggagtca
gaccatttcagcacagagcttgatgatatcactgtcactgacacttacctgtctgccaca
aaagtgtcttttgatgacacctgcttggcttctgaggtatcctttagccaaagttga

DBGET integrated database retrieval system