KEGG   Homo sapiens (human): 7205Help
Entry
7205              CDS       T01001                                 

Gene name
TRIP6, OIP-1, OIP1, TRIP-6, TRIP6i2, ZRP-1
Definition
(RefSeq) thyroid hormone receptor interactor 6
  KO
K12792  thyroid receptor-interacting protein 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    7205 (TRIP6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LIM
Motif
Other DBs
NCBI-GeneID: 7205
NCBI-ProteinID: NP_003293
OMIM: 602933
HGNC: 12311
Ensembl: ENSG00000087077
Vega: OTTHUMG00000157029
Pharos: Q15654(Tbio)
UniProt: Q15654
Structure
PDB: 

Position
7q22.1
AA seq 476 aa AA seqDB search
MSGPTWLPPKQPEPARAPQGRAIPRGTPGPPPAHGAALQPHPRVNFCPLPSEQCYQAPGG
PEDRGPAWVGSHGVLQHTQGLPADRGGLRPGSLDAEIDLLSSTLAELNGGRGHASRRPDR
QAYEPPPPPAYRTGSLKPNPASPLPASPYGGPTPASYTTASTPAGPAFPVQVKVAQPVRG
CGPPRRGASQASGPLPGPHFPLPGRGEVWGPGYRSQREPGPGAKEEAAGVSGPAGRGRGG
EHGPQVPLSQPPEDELDRLTKKLVHDMNHPPSGEYFGQCGGCGEDVVGDGAGVVALDRVF
HVGCFVCSTCRAQLRGQHFYAVERRAYCEGCYVATLEKCATCSQPILDRILRAMGKAYHP
GCFTCVVCHRGLDGIPFTVDATSQIHCIEDFHRKFAPRCSVCGGAIMPEPGQEETVRIVA
LDRSFHIGCYKCEECGLLLSSEGECQGCYPLDGHILCKACSAWRIQELSATVTTDC
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtcggggcccacctggctgcccccgaagcagccggagcccgccagagcccctcagggg
agggcgatcccccgcggcaccccggggccaccaccggcccacggagcagcactccagccc
caccccagggtcaatttttgcccccttccatctgagcagtgttaccaggccccaggggga
ccggaggatcgggggccggcgtgggtggggtcccatggagtactccagcacacgcagggg
ctccctgcagacagggggggccttcgccctggaagcctggacgccgagatagacttgctg
agcagcacgctggccgagctgaatgggggtcggggtcatgcgtcacggcgaccagaccga
caggcatatgagcccccgccacctcctgcctaccgcacgggctccctgaagccaaatcca
gcctcgccgctcccagcgtctccctatgggggccccactccagcctcttacactaccgcc
agcaccccggctggcccagccttccccgtgcaagtgaaggtggcacagccagtgaggggc
tgcggcccacccaggcggggagcctctcaggcctctgggcccctcccgggcccccacttt
cctctcccaggccgaggtgaagtctgggggcctggctataggagccagagagagccaggg
ccaggggccaaagaggaagctgctggggtctctggccctgcaggaagaggaagaggaggc
gagcacgggccccaggtgcccctgagccagcctccagaggatgagctggataggctgacg
aagaagctggttcacgacatgaaccacccgcccagcggggagtactttggccagtgtggt
ggctgcggagaagatgtggttggggatggggctggggttgtggcccttgatcgcgtcttt
cacgtgggctgctttgtatgttctacatgccgggcccagcttcgcggccagcatttctac
gccgtggagaggagggcatattgcgagggctgctacgtggccaccctggagaaatgtgcc
acgtgctcccagcccatcctggaccggatcctgcgggctatggggaaggcctaccaccct
ggctgcttcacctgcgtggtgtgtcaccgcggcctcgacggcatccccttcacagtggat
gctacgagccagatccactgcattgaggactttcacaggaagtttgccccaagatgctca
gtgtgcggtggggccataatgcctgagccaggtcaggaggagactgtgagaattgttgct
ctggatcgaagttttcacattggctgttacaagtgcgaggagtgtgggctgctgctctcc
tctgagggcgagtgtcagggctgctacccgctggatgggcacatcttgtgcaaggcctgc
agcgcctggcgcatccaggagctctcagccaccgtcaccactgactgctga

DBGET integrated database retrieval system