KEGG   Homo sapiens (human): 7223Help
Entry
7223              CDS       T01001                                 

Gene name
TRPC4, HTRP-4, HTRP4, TRP4
Definition
(RefSeq) transient receptor potential cation channel subfamily C member 4
  KO
K04967  transient receptor potential cation channel subfamily C member 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    7223 (TRPC4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    7223 (TRPC4)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   7223 (TRPC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans TRP_2 Ank_4 Ank_2 Ank_3 Ank PKD_channel
Motif
Other DBs
NCBI-GeneID: 7223
NCBI-ProteinID: NP_057263
OMIM: 603651
HGNC: 12336
Ensembl: ENSG00000133107
Vega: OTTHUMG00000016752
Pharos: Q9UBN4(Tbio)
UniProt: Q9UBN4
Position
13q13.3
AA seq 977 aa AA seqDB search
MAQFYYKRNVNAPYRDRIPLRIVRAESELSPSEKAYLNAVEKGDYASVKKSLEEAEIYFK
ININCIDPLGRTALLIAIENENLELIELLLSFNVYVGDALLHAIRKEVVGAVELLLNHKK
PSGEKQVPPILLDKQFSEFTPDITPIILAAHTNNYEIIKLLVQKGVSVPRPHEVRCNCVE
CVSSSDVDSLRHSRSRLNIYKALASPSLIALSSEDPFLTAFQLSWELQELSKVENEFKSE
YEELSRQCKQFAKDLLDQTRSSRELEIILNYRDDNSLIEEQSGNDLARLKLAIKYRQKEF
VAQPNCQQLLASRWYDEFPGWRRRHWAVKMVTCFIIGLLFPVFSVCYLIAPKSPLGLFIR
KPFIKFICHTASYLTFLFLLLLASQHIDRSDLNRQGPPPTIVEWMILPWVLGFIWGEIKQ
MWDGGLQDYIHDWWNLMDFVMNSLYLATISLKIVAFVKYSALNPRESWDMWHPTLVAEAL
FAIANIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFY
YEETKGLTCKGIRCEKQNNAFSTLFETLQSLFWSIFGLINLYVTNVKAQHEFTEFVGATM
FGTYNVISLVVLLNMLIAMMNNSYQLIADHADIEWKFARTKLWMSYFEEGGTLPTPFNVI
PSPKSLWYLIKWIWTHLCKKKMRRKPESFGTIGRRAADNLRRHHQYQEVMRNLVKRYVAA
MIRDAKTEEGLTEENFKELKQDISSFRFEVLGLLRGSKLSTIQSANASKESSNSADSDEK
SDSEGNSKDKKKNFSLFDLTTLIHPRSAAIASERHNISNGSALVVQEPPREKQRKVNFVT
DIKNFGLFHRRSKQNAAEQNANQIFSVSEEVARQQAAGPLERNIQLESRGLASRGDLSIP
GLSEQCVLVDHRERNTDTLGLQVGKRVCPFKSEKVVVEDTVPIIPKEKHAKEEDSSIDYD
LNLPDTVTHEDYVTTRL
NT seq 2934 nt NT seq  +upstreamnt  +downstreamnt
atggctcagttctattacaaaagaaatgttaatgctccctatagagaccgcatccctcta
aggatagtaagagcagaatcagaactctcgccatcagaaaaagcctacttgaatgctgtg
gaaaagggagattatgccagtgtcaagaaatccctagaggaagctgaaatttattttaaa
atcaatattaattgcattgatcctctcggaagaactgctctcctcattgcaattgaaaat
gagaacttggagctcatcgaactactcttaagctttaatgtctatgttggagatgctcta
ttacatgctatcagaaaagaagtcgtcggagctgttgagctgttattgaaccacaaaaaa
cctagtggagaaaaacaggtgcctcctatactccttgataagcagttctctgaattcact
ccagacattacaccaatcattttggcagcccatacaaataattatgagataataaaactc
ttggttcagaaaggagtctcagtgcctcgaccccacgaggtccgctgtaactgtgtggaa
tgcgtgtccagttcagatgtggacagcctccgtcactcacgctccagactcaacatctac
aaggccttggccagtccctctctcattgcactgtcaagcgaagatccttttctcacagcc
tttcagttaagttgggaacttcaggaactgagcaaggtggaaaatgaattcaagtcggag
tatgaagagctgtcacggcagtgcaaacaatttgctaaggacctactggatcagacgaga
agttccagagaactggaaatcattcttaattaccgagatgacaatagtctcatagaagaa
caaagtggaaatgatcttgcaagactaaaattggccattaagtaccgtcaaaaagagttt
gttgcccagcccaattgtcaacagctgctggcatctcgctggtacgatgagtttccaggc
tggaggagaagacactgggcagtgaagatggtgacatgtttcataataggacttcttttt
cctgtcttctctgtgtgctacctgatagctcccaaaagcccacttggactgttcatcagg
aagccatttatcaagtttatctgccacacagcctcctatttgacttttttgttcctgctg
ctgcttgcctctcagcacatcgacaggtcagacttgaacaggcaaggtccaccaccaacc
atcgtcgagtggatgatattaccgtgggtcctgggcttcatatggggagaaattaaacag
atgtgggatggcggacttcaggactacatccatgattggtggaatctaatggactttgta
atgaactccttatatttagcaacaatctccttgaaaattgttgcatttgtaaagtacagt
gcccttaatccacgagaatcatgggacatgtggcatcccactctggtggcagaggcttta
tttgctattgcaaacatcttcagttctctgcgtctgatctcactgtttactgcaaattct
cacctgggacctctgcaaatatctctgggaagaatgctcctggacattttgaagtttcta
ttcatatactgccttgtgttgctagcatttgcaaatggcctaaatcaattgtacttctat
tatgaagaaacgaaagggttaacctgcaaaggcataagatgtgaaaagcagaataatgca
ttttcaacgttatttgagacactgcagtccctgttttggtcaatatttgggctcatcaat
ttatatgtgaccaatgtcaaagcacagcatgaatttactgagtttgttggtgccaccatg
tttgggacatacaatgtcatctctctggttgttctactcaacatgttaatagctatgatg
aataattcttaccaactgattgctgaccatgcagatatagaatggaaatttgcacgaaca
aagctttggatgagttattttgaagaaggaggtactctgcctactcccttcaatgtcatc
ccgagccccaagtctctctggtacctgatcaaatggatctggacacacttgtgcaagaaa
aagatgagaagaaagccagaaagttttggaacaatagggaggcgagctgctgataacttg
agaagacatcaccaataccaagaagttatgaggaacctggtgaagcgatacgttgctgca
atgattagagatgctaaaactgaagaaggcctgaccgaagagaactttaaggaactaaag
caagacatttctagtttccgctttgaagtcctgggattactaagaggaagcaaactttcc
acaatacaatctgcgaatgcctcgaaggagtcttcaaattcggcagactcagatgaaaag
agtgatagcgaaggtaatagcaaggacaagaaaaagaatttcagcctttttgatttaacc
accctgattcatccgagatcagcagcaattgcctctgaaagacataacataagcaatggc
tctgccctggtggttcaggagccgcccagggagaagcagagaaaagtgaattttgtgacc
gatatcaaaaactttgggttatttcatagacgatcaaaacaaaatgctgctgagcaaaat
gcaaaccaaatcttctctgtttcagaagaagttgctcgtcaacaggctgcaggaccactt
gagagaaatattcaactggaatctcgaggattagcttcacggggtgacctgagcattccc
ggtctcagtgaacaatgtgtgttagtagaccatagagaaaggaatacggacacactgggg
ttacaggtaggaaagagagtgtgtccattcaagtcagagaaggtggtggtggaggacacg
gttcctataataccaaaggagaaacatgcaaaagaagaggactctagtatagactatgat
ctaaacctcccagacacagtcacccacgaagattacgtgaccacaagattgtga

DBGET integrated database retrieval system