KEGG   Homo sapiens (human): 7247
Entry
7247              CDS       T01001                                 

Gene name
TSN, BCLF-1, C3PO, RCHF1, REHF-1, TBRBP, TRSLN
Definition
(RefSeq) translin
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Translin
Other DBs
NCBI-GeneID: 7247
NCBI-ProteinID: NP_004613
OMIM: 600575
HGNC: 12379
Ensembl: ENSG00000211460
Vega: OTTHUMG00000153334
Pharos: Q15631(Tbio)
UniProt: Q15631
Structure
PDB: 
1J1J 3QB5 4WYV 3PJA

Position
2q14.3
AA seq 228 aa
MSVSEIFVELQGFLAAEQDIREEIRKVVQSLEQTAREILTLLQGVHQGAGFQDIPKRCLK
AREHFGTVKTHLTSLKTKFPAEQYYRFHEHWRFVLQRLVFLAAFVVYLETETLVTREAVT
EILGIEPDREKGFHLDVEDYLSGVLILASELSRLSVNSVTAGDYSRPLHISTFINELDSG
FRLLNLKNDSLRKRYDGLKYDVKKVEEVVYDLSIRGFNKETAAACVEK
NT seq 687 nt   +upstreamnt  +downstreamnt
atgtctgtgagcgagatcttcgtggagctgcagggctttttggctgccgagcaggacatc
cgagaggaaatcagaaaagttgtacagagtttagaacaaacagctcgagagattttaact
ctactgcaaggggtccatcagggtgctgggtttcaggacattccaaagaggtgtttgaaa
gctcgagaacattttggtacagtaaaaacacatctaacatctttgaagaccaaatttcct
gctgaacagtattacagatttcatgagcactggaggtttgtgttgcagcgcttggtcttc
ttggcagcatttgttgtgtatttggaaacagaaacactagtgactcgagaagcagttaca
gaaattcttggcattgagccagatcgggagaaaggatttcatctggatgtagaagattat
ctctcaggagttctaattcttgccagtgaactgtcgaggctgtctgtcaacagcgtgact
gctggagactactcccgacccctccacatctccaccttcatcaatgagctggattccggt
tttcgccttctcaacctgaaaaatgactccctgaggaagcgctacgacggattgaaatat
gacgtgaagaaagtagaggaagtggtctatgatctctccatccggggctttaataaggag
acggcagcagcttgtgttgaaaaatag

DBGET integrated database retrieval system