KEGG   Homo sapiens (human): 7252Help
Entry
7252              CDS       T01001                                 

Gene name
TSHB, TSH-B, TSH-BETA
Definition
(RefSeq) thyroid stimulating hormone subunit beta
  KO
K05251  thyrotropin subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04918  Thyroid hormone synthesis
hsa04923  Regulation of lipolysis in adipocytes
hsa05320  Autoimmune thyroid disease
Network
nt06322  TRH-TSH-TH signaling
  Element
N00782  TSH-TG signaling pathway
N00783  Mutation-inactivated TSH to TSH-TG signaling pathway
N00784  Mutation-inactivated TSHR to TSH-TG signaling pathway
N00785  Mutation-inactivated PAX8 to TSH-TG signaling pathway
N00793  TSH-DUOX2-TG signaling pathway
N00794  Mutation-inactivated DUOX2 to TSH-DUOX2-TG signaling pathway
N00797  Mutation-activated TSHR to TSH-TG signaling pathway
N00918  TRH-TRHR-PLCB-PKC signaling pathway
N00919  Mutation-inactivated TRHR to PLCB-PKC signaling pathway
Disease
H00250  Congenital nongoitrous hypothyroidism (CHNG)
H01699  Isolated TSH deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    7252 (TSHB)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    7252 (TSHB)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    7252 (TSHB)
   04918 Thyroid hormone synthesis
    7252 (TSHB)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    7252 (TSHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cys_knot
Motif
Other DBs
NCBI-GeneID: 7252
NCBI-ProteinID: NP_000540
OMIM: 188540
HGNC: 12372
Ensembl: ENSG00000134200
Vega: OTTHUMG00000011881
Pharos: P01222(Tbio)
CPD: C18182
UniProt: P01222
Position
1p13.2
AA seq 138 aa AA seqDB search
MTALFLMSMLFGLTCGQAMSFCIPTEYTMHIERRECAYCLTINTTICAGYCMTRDINGKL
FLPKYALSQDVCTYRDFIYRTVEIPGCPLHVAPYFSYPVALSCKCGKCNTDYSDCIHEAI
KTNYCTKPQKSYLVGFSV
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgactgctctctttctgatgtccatgctttttggccttacatgtgggcaagcgatgtct
ttttgtattccaactgagtatacaatgcacatcgaaaggagagagtgtgcttattgccta
accatcaacaccaccatctgtgctggatattgtatgacacgggatatcaatggcaaactg
tttcttcccaaatatgctctgtcccaggatgtttgcacatatagagacttcatctacagg
actgtagaaataccaggatgcccactccatgttgctccctatttttcctatcctgttgct
ttaagctgtaagtgtggcaagtgcaatactgactatagtgactgcatacatgaagccatc
aagacaaactactgtaccaaacctcagaagtcttatctggtaggattttctgtctaa

DBGET integrated database retrieval system