KEGG   Homo sapiens (human): 726Help
Entry
726               CDS       T01001                                 

Gene name
CAPN5, ADNIV, HTRA3, VRNI, nCL-3
Definition
(RefSeq) calpain 5
  KO
K08574  calpain-5 [EC:3.4.22.-]
Organism
hsa  Homo sapiens (human)
Disease
H01798  Autosomal dominant neovascular inflammatory vitreoretinopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    726 (CAPN5)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     726 (CAPN5)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C2: calpain family
   726 (CAPN5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C2 Calpain_III
Motif
Other DBs
NCBI-GeneID: 726
NCBI-ProteinID: NP_004046
OMIM: 602537
HGNC: 1482
Ensembl: ENSG00000149260
Vega: OTTHUMG00000165192
Pharos: O15484(Tbio)
UniProt: O15484 A0A140VKH4
Position
11q13.5
AA seq 640 aa AA seqDB search
MFSCVKPYEDQNYSALRRDCRRRKVLFEDPLFPATDDSLYYKGTPGPAVRWKRPKGICED
PRLFVDGISSHDLHQGQVGNCWFVAACSSLASRESLWQKVIPDWKEQEWDPEKPNAYAGI
FHFHFWRFGEWVDVVIDDRLPTVNNQLIYCHSNSRNEFWCALVEKAYAKLAGCYQALDGG
NTADALVDFTGGVSEPIDLTEGDFANDETKRNQLFERMLKVHSRGGLISASIKAVTAADM
EARLACGLVKGHAYAVTDVRKVRLGHGLLAFFKSEKLDMIRLRNPWGEREWNGPWSDTSE
EWQKVSKSEREKMGVTVQDDGEFWMTFEDVCRYFTDIIKCRVINTSHLSIHKTWEEARLH
GAWTLHEDPRQNRGGGCINHKDTFFQNPQYIFEVKKPEDEVLICIQQRPKRSTRREGKGE
NLAIGFDIYKVEENRQYRMHSLQHKAASSIYINSRSVFLRTDQPEGRYVIIPTTFEPGHT
GEFLLRVFTDVPSNCRELRLDEPPHTCWSSLCGYPQLVTQVHVLGAAGLKDSPTGANSYV
IIKCEGDKVRSAVQKGTSTPEYNVKGIFYRKKLSQPITVQVWNHRVLKDEFLGQVHLKAD
PDNLQALHTLHLRDRNSRQPSNLPGTVAVHILSSTSLMAV
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgttctcgtgtgtgaagccctatgaggaccagaactactcagccctgaggcgggactgc
cggcgcaggaaggtgctcttcgaggaccccctcttccccgccactgacgactcactctac
tataagggcacgccggggcccgccgtcaggtggaagcgacccaagggcatctgcgaggac
ccccgcctctttgtggatggcatcagctcccacgacctgcaccagggccaggtgggcaac
tgctggtttgtggcagcctgctcgtcacttgcctcccgggagtcgctgtggcaaaaggtc
atcccagactggaaggagcaggaatgggaccccgaaaagcccaacgcctacgcgggcatc
ttccacttccacttctggcgcttcggggaatgggtggacgtggtcatcgatgaccggctg
cccacagtcaacaaccagctcatctactgccactccaactcccgcaatgagttttggtgc
gccctagtggagaaggcctatgccaaactggcaggctgttaccaggccctggatggaggc
aacacagcagacgcactggtggacttcacgggtggtgtttctgagcccatcgacctgacc
gagggtgactttgccaacgatgagactaagaggaaccagctctttgagcgcatgttaaag
gtgcacagccggggcggcctcatcagtgcctccatcaaggcagtgacagcagctgacatg
gaggcccgcctggcgtgcggcctggtaaagggccacgcatacgccgtcactgatgtgcgc
aaggtgcgcctgggccacggcctactggccttcttcaagtcagagaagttggacatgatc
cgcctgcgcaacccctggggcgagcgggagtggaacgggccctggagtgacacctcggag
gagtggcagaaagtgagcaagagtgagcgggagaagatgggtgtgaccgtgcaggacgac
ggtgagttctggatgaccttcgaggacgtgtgccggtacttcacggacatcatcaagtgc
cgcgtgatcaacacatcccacctgagcatccacaagacgtgggaggaggcccggctgcat
ggcgcctggacgctgcatgaggacccgcgacagaaccgcggtggcggctgcatcaaccac
aaggacaccttcttccagaacccacagtacatcttcgaagtcaagaagccagaagatgaa
gtcctgatctgcatccagcagcggccaaagcggtctacgcgccgggagggcaagggtgag
aacctggccattggctttgacatctacaaggtggaggagaaccgccagtaccgcatgcac
agcctgcagcacaaggccgccagctccatctacatcaactcacgcagcgtcttcctgcgc
accgaccagcccgagggccgctatgtcatcatccccacaaccttcgagccaggccacact
ggcgagttcctgctccgagtcttcactgatgtgccctccaactgccgggagctgcgcctg
gatgagcccccacacacctgctggagctccctctgtggctacccccagctggtgacccag
gtacatgtcctgggagctgctggcctcaaggactccccaacaggggctaactcttatgtg
atcatcaagtgtgagggagacaaagtccgctcggctgtgcagaagggcacctccacacca
gagtacaatgtgaaaggcatcttctaccgcaagaagctgagccagcccatcactgtacag
gtctggaaccaccgagtgctgaaggatgaatttctgggccaggtgcacctaaaggctgac
ccggacaacctccaggccctgcataccctccacctccgggaccgaaatagccggcagccc
agcaacctgccaggcactgtggccgtgcacattctcagcagcacctccctcatggctgtc
tga

DBGET integrated database retrieval system